KEGG   Bacillus subtilis subsp. subtilis 168: BSU31959Help
Entry
BSU31959          CDS       T00010                                 

Gene name
ybdZ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MbtH
Motif
Other DBs
NCBI-GeneID: 8303138
NCBI-ProteinID: YP_003097779
UniProt: C0H3Q6
Position
complement(3280294..3280503)
Genome map
AA seq 69 aa AA seqDB search
MANPFENADGTYLVLVNEEGQYSLWPGFIDVPSGWTVVHEQKGREACLDYIQSHWSDMRP
NSLKTVENV
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatccttttgaaaatgcggatggcacatatttggtgctggtcaatgaagaaggc
caatattccctatggccgggttttatagatgtgccgagcggctggacagtcgttcatgag
caaaaagggcgtgaagcttgtttggactatatccaatcgcattggagcgatatgaggcca
aacagcctaaagactgttgaaaatgtgtaa

DBGET integrated database retrieval system