KEGG   Bacillus subtilis subsp. subtilis 168: BSU31970Help
Entry
BSU31970          CDS       T00010                                 

Gene name
dhbB
Definition
(RefSeq) isochorismatase
  KO
K01252  bifunctional isochorismate lyase / aryl carrier protein [EC:3.3.2.1 6.3.2.14]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01053  Biosynthesis of siderophore group nonribosomal peptides
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    BSU31970 (dhbB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU31970 (dhbB)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.1  isochorismatase
     BSU31970 (dhbB)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     BSU31970 (dhbB)
Polyketide biosynthesis proteins [BR:bsu01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    BSU31970 (dhbB)
   Bacillibactin synthetase
    BSU31970 (dhbB)
  Nonlinear NRPS
   Vibriobactin synthetase
    BSU31970 (dhbB)
   Myxochelin synthetase
    BSU31970 (dhbB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase PP-binding ZnuA
Motif
Other DBs
NCBI-GeneID: 936582
NCBI-ProteinID: NP_391077
Pasteur: BG11241
BSORF: BG11241
UniProt: P45743
Position
complement(3287675..3288613)
Genome map
AA seq 312 aa AA seqDB search
MAIPAIQPYQMPTASDMPQNKVSWVPDPNRAVLLIHDMQNYFVDAFTAGASPVTELSANI
RKLKNQCVQLGIPVVYTAQPGSQNPDDRALLTDFWGPGLNSGPYEEKIITELAPEDDDLV
LTKWRYSAFKRTNLLEMMRKEGRDQLIITGIYAHIGCLVTACEAFMEDIKAFFVGDAVAD
FSLEKHQMALEYAAGRCAFTVMTDSLLDQLQNAPADVQKTSANTGKKNVFTCENIRKQIA
ELLQETPEDITDQEDLLDRGLDSVRIMTLVEQWRREGAEVTFVELAERPTIEEWQKLLTT
RSQQVLPNADYL
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggctatacctgccattcagccgtatcaaatgccgacagcatctgatatgccgcaaaac
aaagtatcatgggtgcctgatccgaatcgggctgtcttgttaatacacgatatgcaaaac
tattttgttgatgctttcacagcgggagcgtctccggtaacagagctttcagcgaatata
cgaaagctgaagaatcaatgtgttcagcttgggattcctgttgtctataccgcacagccg
ggaagccaaaatccggatgaccgtgcgctgctgacagacttttggggcccgggattaaac
agcggtccttatgaggagaaaattataaccgagctggcaccagaggatgatgatcttgtg
ctgacaaaatggagatacagcgcgtttaagagaacgaatctgcttgaaatgatgcgcaaa
gagggacgcgatcagctgatcattacaggaatttacgcccatatcggctgtcttgttaca
gcatgtgaagcatttatggaggatattaaagccttttttgtgggagatgcagttgctgat
ttttcattagaaaaacatcaaatggcgctggaatatgcggctggacgctgtgcgtttacc
gtgatgactgacagtcttcttgatcagctgcagaatgcgccggcagacgttcaaaaaacg
tcagcaaacactggcaaaaagaacgtgtttacatgtgagaatatccgtaaacaaattgct
gagcttctacaagaaacaccggaagacatcacagatcaagaggatttgctcgatcgtggt
cttgattcggtaaggatcatgacattggtggaacaatggcgccgtgaaggggcagaggtg
actttcgtggaattggctgaacgcccaacgatcgaagaatggcagaaattgctcacaact
cgcagccagcaagtgctgccaaacgcggattatttataa

DBGET integrated database retrieval system