KEGG   Bacillus subtilis subsp. subtilis 168: BSU31980Help
Entry
BSU31980          CDS       T00010                                 

Gene name
dhbE
Definition
(RefSeq) 2,3-dihydroxybenzoate-AMP ligase
  KO
K02363  2,3-dihydroxybenzoate-AMP ligase [EC:6.3.2.14 2.7.7.58]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01053  Biosynthesis of siderophore group nonribosomal peptides
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    BSU31980 (dhbE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bsu01008]
    BSU31980 (dhbE)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.58  (2,3-dihydroxybenzoyl)adenylate synthase
     BSU31980 (dhbE)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     BSU31980 (dhbE)
Polyketide biosynthesis proteins [BR:bsu01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    BSU31980 (dhbE)
   Bacillibactin synthetase
    BSU31980 (dhbE)
  Nonlinear NRPS
   Vibriobactin synthetase
    BSU31980 (dhbE)
   Myxochelin synthetase
    BSU31980 (dhbE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C SAP
Motif
Other DBs
NCBI-GeneID: 936509
NCBI-ProteinID: NP_391078
Pasteur: BG11020
BSORF: BG11020
UniProt: P40871
Structure
PDB: 

Position
complement(3288641..3290260)
Genome map
AA seq 539 aa AA seqDB search
MLKGFTPWPDELAETYRKNGCWAGETFGDLLRDRAAKYGDRIAITCGNTHWSYRELDTRA
DRLAAGFQKLGIQQMDRVVVQLPNIKEFFEVIFALFRLGALPVFALPSHRSSEITYFCEF
AEAAAYIIPDAYSGFDYRSLARQVQSKLPTLKNIIVAGEAEEFLPLEDLHAEPVKLPEVK
SSDVAFLQLSGGSTGLSKLIPRTHDDYIYSLKRSVEVCWLDHSTVYLAALPMAHNYPLSS
PGVLGVLYAGGRVVLSPSPSPDDAFPLIEREKVTITALVPPLAMVWMDAASSRRDDLSSL
QVLQVGGAKFSAEAARRVKAVFGCTLQQVFGMAEGLVNYTRLDDPEEIIVNTQGKPMSPY
DEMRVWDDHDRDVKPGETGHLLTRGPYTIRGYYKAEEHNAASFTEDGFYRTGDIVRLTRD
GYIVVEGRAKDQINRGGEKVAAEEVENHLLAHPAVHDAAMVSMPDQFLGERSCVFIIPRD
EAPKAAELKAFLRERGLAAYKIPDRVEFVESFPQTGVGKVSKKALREAISEKLLAGFKK
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaggatttacgccttggcctgatgagttagctgagacctatcgaaagaacggc
tgctgggccggtgagacgtttggagatttgttaagggaccgggcagccaaatatggtgat
cgcattgccattacatgcggaaacacccattggagctatcgagagcttgacacaagggct
gatcgcctggctgccggatttcaaaagctcggcattcaacagatggatcgtgttgtggtg
cagttgccaaatatcaaagagttttttgaagtcattttcgcgcttttccgtctgggggcg
cttccagtcttcgcactgccttctcatcgaagcagtgaaattacatatttttgcgagttt
gctgaagcggctgcatatatcattcccgacgcttattccggttttgactaccgttcgctt
gccagacaggttcaaagcaagctgccgactttgaaaaacatcattgtcgcaggtgaggca
gaggaatttttaccgctggaggatttgcatgcagaacctgtaaaactgcctgaagtcaaa
tcatcggatgtggcgttcctccagctttctggcgggagcaccgggctatcgaaactgatt
ccgaggacccacgatgactacatatacagcctgaagcggagtgtggaggtctgctggctc
gaccacagcacggtgtacttggccgcgctgccgatggcacacaattatccgctgagctca
cccggcgttctcggcgtattatacgctggaggaagagtggtattatctccttctccaagt
ccagatgacgcatttcctttaattgaacgggaaaaggtcacgataaccgctcttgttccg
cctcttgcgatggtatggatggatgcggcatcctcacgccgtgatgatttatccagcctt
caagtgctgcaggtcggcggtgccaagtttagtgctgaagccgcgcgcagggtaaaagct
gttttcggctgcacgctgcagcaggtgttcggaatggcagagggtctcgtcaattatacg
agattggatgatcctgaggagatcattgtcaacacccaaggaaaaccgatgtctccatat
gatgaaatgcgtgtttgggatgatcatgatcgcgacgtaaaacctggtgaaacaggccat
ctgctgacgcgggggccgtatacaattcgaggttactataaggcagaagagcataacgcc
gcttcatttactgaggacggtttttaccgtacgggtgatatcgtcaggctgacacgagac
ggctatattgtcgttgaaggccgggcgaaggatcaaattaaccgtggaggagaaaaggtt
gcggctgaagaggtagaaaatcatctgctggcgcatccggctgtccatgatgcggcaatg
gtctccatgcctgatcaatttcttggcgaaagatcttgtgtgttcattattccccgggat
gaagccccaaaagccgcagagcttaaagcatttttgagagagcgcggactggcggcatat
aaaatccctgatcgagttgaatttgtcgaatccttcccgcagacaggagtaggaaaagtc
agcaaaaaagcgctccgtgaagccatttccgagaagcttcttgcaggatttaaaaaataa

DBGET integrated database retrieval system