KEGG   Bacillus subtilis subsp. subtilis 168: BSU31990Help
Entry
BSU31990          CDS       T00010                                 

Gene name
dhbC
Definition
(RefSeq) isochorismate synthase DhbC
  KO
K02361  isochorismate synthase [EC:5.4.4.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00130  Ubiquinone and other terpenoid-quinone biosynthesis
bsu01053  Biosynthesis of siderophore group nonribosomal peptides
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BSU31990 (dhbC)
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    BSU31990 (dhbC)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     BSU31990 (dhbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind
Motif
Other DBs
NCBI-GeneID: 937162
NCBI-ProteinID: NP_391079
Pasteur: BG11242
BSORF: BG11242
UniProt: P45744
Position
complement(3290289..3291485)
Genome map
AA seq 398 aa AA seqDB search
MLDQNVITETKAEHLLHEYQPGAFFLASPHRVLLAKGICEIVPEADGQNQMETLSGRIAE
ALRQAKQSGQSRPLVVGAVPFDQVKAARLVVPEEVRWSGPLQFDHEEKEQQAGHTYHIKP
VPEPEDYKNGVEQGLARIADGTLSKIVLSRSLHLTSPEPIQTDELLRHLAQHNSHGYTFA
ADVSSQEETSPRRTLLGASPELLVSRMGTQVVSNPLAGSRPRSNDPVEDQRRAAELLSSA
KDLHEHAVVADAVAAALRPFCRTLEVPEKPSLIKTETMWHLSSVIKGELSDPSVTALELA
AALHPTPAVCGTPTDLAREAILSIEPFDRGFFTGMVGWCDDAGDGEWIVTIRCAEAEERS
LRLYAGAGVVAGSKPEDELQETSAKFRTMLRAMGVDHI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgttggatcaaaacgttataacagaaacaaaagcggagcatttgcttcatgaatatcag
ccgggcgcctttttcttagcgtctcctcatcgtgtactgttagcgaaaggcatatgtgaa
attgtaccggaggcagacgggcaaaaccaaatggaaaccctttctggccgaattgcagag
gcgttacgtcaggcaaaacaatcagggcaaagccggccgcttgttgtcggggccgttcct
tttgatcaagtaaaagcagcgcggctcgttgtacctgaagaagtgcgctggtcaggaccg
cttcaatttgatcatgaggaaaaggaacagcaggctgggcatacataccacataaagcct
gttcctgaacctgaggattataaaaatggtgttgaacaagggctggcacgcattgccgat
ggaacactcagcaaaatcgtcctgtccagatcgctgcatttgacatcgcctgaaccgatt
cagacggatgaattgcttcgccatctggctcagcataactcgcatggctacacgtttgcc
gcagacgtgtccagtcaggaggaaacgtctccccgcagaacattgctcggagcaagtccg
gagcttctcgtttcaaggatgggaacacaggtcgtttccaacccattagccggctcaaga
ccgcgcagtaatgatcctgttgaagaccagcgccgggcagctgaattgctttcttccgca
aaggatcttcatgagcacgcggttgtcgctgacgcggttgcggcagcgctgagacctttc
tgccggacgctggaggttccggagaagccttcactgatcaaaacggaaacgatgtggcac
ctgtccagcgtgattaagggagagctttccgacccgtctgtaaccgcacttgaattggcg
gcggcgctccacccgacgccagccgtctgcggaacaccgactgatcttgcaagagaagcg
attctcagcattgaaccatttgaccgcggtttctttaccggcatggtcggatggtgtgac
gatgccggtgacggagaatggatcgtgaccatccgttgtgcagaagcagaagaacgctca
ctccgcctgtatgctggagctggtgttgtggccggttcaaagcctgaggacgagcttcag
gagacgtccgcaaagtttcggacaatgctgcgggcaatgggcgtggatcacatatga

DBGET integrated database retrieval system