KEGG   Bacillus subtilis subsp. subtilis 168: BSU32000Help
Entry
BSU32000          CDS       T00010                                 

Gene name
dhbA
Definition
(RefSeq) 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase
  KO
K00216  2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase [EC:1.3.1.28]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu01053  Biosynthesis of siderophore group nonribosomal peptides
bsu01110  Biosynthesis of secondary metabolites
bsu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    BSU32000 (dhbA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.28  2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase
     BSU32000 (dhbA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase TrkA_N ADH_zinc_N NAD_binding_10 3HCDH_N Methyltransf_25
Motif
Other DBs
NCBI-GeneID: 936579
NCBI-ProteinID: NP_391080
Pasteur: BG11019
BSORF: BG11019
UniProt: P39071
Position
complement(3291511..3292296)
Genome map
AA seq 261 aa AA seqDB search
MNAKGIEGKIAFITGAAQGIGEAVARTLASQGAHIAAVDYNPEKLEKVVSSLKAEGRHAE
AFPADVRDSAAIDEITARIEREMGPIDILVNVAGVLRPGLIHSLSDEEWEATFSVNSTGV
FNASRSVSKYMMDRRSGSIVTVGSNAAGVPRTSMAAYASSKAAAVMFTKCLGLELAEYNI
RCNIVSPGSTETDMQWSLWADENGAEQVIKGSLETFKTGIPLKKLAKPSDIADAVLFLVS
GQAGHITMHNLCVDGGATLGV
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaagggtatagagggaaaaattgcttttataacaggggctgcccaaggaata
ggcgaagctgttgcgcggacgcttgccagtcaaggcgcacatattgcggcagttgattat
aatcctgaaaagctggaaaaggttgtgagcagcctcaaagcagaaggccgccatgcagaa
gcttttcctgcggatgtgagagacagcgcggcgattgacgagatcacggcgcgcatcgaa
cgtgaaatggggccgattgatattttagtgaatgtagcgggtgtccttcgcccgggactg
atccattcgcttagcgatgaggaatgggaggcgacgttctcagtgaattcgactggcgta
tttaacgcctcgcgttcagtcagcaaatatatgatggaccgaagatcgggttcgattgta
acagtcggatcgaatgctgccggtgtaccaagaacatctatggcggcatatgcgtcttca
aaggctgcggctgtgatgtttacgaaatgccttggccttgagcttgcagaatacaatatt
cgctgcaacattgtatctcccggatcaacggaaacagacatgcagtggtcattatgggcc
gacgagaatggagcggagcaagtcataaaaggatcacttgagacatttaaaacagggatc
ccgctcaaaaaactagccaagccttcggatattgcggatgcggtgctctttttggtttct
ggccaggcagggcatattacgatgcataatttatgcgtagatggcggcgcgaccttaggc
gtgtaa

DBGET integrated database retrieval system