KEGG   Bacillus subtilis subsp. subtilis 168: BSU32010Help
Entry
BSU32010          CDS       T00010                                 

Gene name
besA
Definition
(RefSeq) ferri-bacillibactin esterase BesA
  KO
K07017  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU32010 (besA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Esterase Peptidase_S9 Hydrolase_4 Abhydrolase_1 LCAT UxuA Mito_fiss_Elm1
Motif
Other DBs
NCBI-GeneID: 936592
NCBI-ProteinID: NP_391081
Pasteur: BG13974
BSORF: BG13974
UniProt: O32102
Position
complement(3292490..3293359)
Genome map
AA seq 289 aa AA seqDB search
MKEQTTDRTNGGTSNAFTIPGTEVRMMSSRNENRTYHIFISKPSTPPPPAGYPVIYLLDA
NSVFGTMTEAVRIQGRRPEKTGVIPAVIVGIGYETAEPFSSARHRDFTMPTAQSKLPERP
DGREWPEHGGAEGFFRFIEEDLKPEIERDYQIDKKRQTIFGHSLGGLFVLQVLLTKPDAF
QTYIAGSPSIHWNKPFILKKTDHFVSLTKKNNQPINILLAAGELEQHHKSRMNDNARELY
ERLAVLSEQGIRAEFCEFSGEGHISVLPVLVSRALRFALHPDGPHLSMG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaaacaacagaccggacaaatggcgggacatcaaacgcatttacgattcct
ggtacggaagtgcgtatgatgtcttcacgcaatgaaaaccgtacctatcacatttttatc
tcgaaacctagtacgccgccgccacccgctggttatcctgtgatttatctgctggatgcc
aattctgtcttcggaacgatgacggaagccgttcgaatacagggacgccgacccgaaaaa
accggggtgatccctgcagtgatcgtcggcattggctatgagacagcggagccgttctcc
tcagcacgccaccgggattttacaatgccaacagcccaatcgaagctgccggaaaggccc
gacggcagagaatggccggagcatggcggagcggagggctttttcagatttattgaagag
gatttaaaaccggagatagaacgagattaccagattgataaaaaaagacaaacaatcttt
ggccattcgctcggagggcttttcgtgctgcaggtgctgctaacaaagcccgatgcgttt
caaacgtatatcgcgggaagtccgtccattcattggaataaaccgtttattctcaagaaa
acggaccatttcgtctctctcaccaagaaaaacaatcagcctatcaatatcctgcttgcc
gcaggagaattagagcagcatcataaaagccggatgaatgataatgcaagggagctttat
gagcggctggccgttttatctgaacaaggtatacgggcagaattttgcgagttttcagga
gaaggacatatttcagttcttcctgttttggtcagcagggcgctgcgttttgcgcttcac
cctgacggaccgcatctatcaatgggctga

DBGET integrated database retrieval system