KEGG   Bacillus subtilis subsp. subtilis 168: BSU32020Help
Entry
BSU32020          CDS       T00010                                 

Gene name
yuiH
Definition
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_molyb
Motif
Other DBs
NCBI-GeneID: 937188
NCBI-ProteinID: NP_391082
Pasteur: BG13973
BSORF: BG13973
UniProt: O32103
Position
complement(3293573..3294169)
Genome map
AA seq 198 aa AA seqDB search
MYFGKTRQSDQSGRVPPNQNVTTSFPVLHTGDVPYYEDMTKWNLQVYGLVDHPMLLSFED
VKAFPRYESKNDIHCVTGWSRLDNVWQGVRACDIAEKAGVKEEAGYVILHAEEGWTTNLP
LDDFLAETSLLAYAHNGEPLTPEHGFPLRGVFPHLYFWKSAKWLRGIQFTKENHPGFWER
NGYHMRGDPWQNQRFTWD
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtatttcggaaaaacaagacagtccgatcaatctggaagagtgccgccaaatcaaaac
gtcaccacttcatttcctgtgcttcataccggagatgtcccatattacgaagatatgacg
aaatggaatcttcaagtatacggtttggttgaccatccgatgctgctaagctttgaagat
gtcaaagcctttccacggtatgaatcgaaaaacgacattcattgcgtcacgggatggtca
aggcttgataatgtgtggcaaggcgtgcgggcttgtgatatagcggaaaaagcgggtgta
aaagaagaagcgggctacgtcattttacatgctgaagagggctggacgaccaatctgccg
cttgatgatttcttagcggaaacttcccttctggcttatgcgcataatggcgaaccttta
acccctgaacacggctttccgctgcggggtgtatttccgcatctgtatttttggaaaagc
gccaagtggctgcgcggcatccaatttacgaaagaaaatcaccctggcttttgggagcgg
aatggctatcacatgagaggcgacccttggcaaaatcaaaggtttacatgggattaa

DBGET integrated database retrieval system