KEGG   Bacillus subtilis subsp. subtilis 168: BSU32030Help
Entry
BSU32030          CDS       T00010                                 

Gene name
bioYB
Definition
(RefSeq) biotin transporter BioYB
  KO
K03523  biotin transport system substrate-specific component
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00582  Energy-coupling factor transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU32030 (bioYB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32030 (bioYB)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Biotin transporter [MD:M00581]
    BSU32030 (bioYB)
   Energy-coupling factor transporter [MD:M00582]
    Substrate-specific components
     BSU32030 (bioYB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BioY DUF378
Motif
Other DBs
NCBI-GeneID: 936511
NCBI-ProteinID: NP_391083
Pasteur: BG13972
BSORF: BG13972
UniProt: O32104
Position
3294270..3294872
Genome map
AA seq 200 aa AA seqDB search
MKQRKLRAGDMALIGMFAALMAVGANITSVAPFLQVAGIPLSMQPFFCLLAALLLGSKRA
AIAMIVYALVGLAGAPVFAQFSAGFAPFAGKSGGFIISYIPAAFAAGWFLERNIQPSKIR
FLIASLIGTAIMYLIGTTYMYLALKLWIHTPVSYGTAWGFMIWFMVKDTALAVILSFIAP
AIYRSIHKATGFNRNHISST
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacgtaaacttcgtgcgggagatatggcgctgattggcatgttcgccgcactt
atggctgtcggggccaacattacatcagtagcaccctttttacaagtagccggcattccg
ctttcgatgcagccgtttttctgtctcttggcagctttgcttcttggcagcaaacgggca
gcgattgccatgattgtatatgcacttgtgggattggccggagcgcctgtgtttgctcaa
ttttcagcaggcttcgcaccgtttgcagggaaaagcggcgggtttattatctcatacatt
ccggcagcatttgcagcgggatggtttttagaacgaaacattcagccaagtaaaattcga
tttctcattgcttcacttatcggaacggcgatcatgtatctcatcggcactacctatatg
tatcttgcactgaagctgtggattcatacgccagtgagctacggcacggcttggggcttt
atgatttggtttatggtaaaagatacagcgctggctgtgatactgtcgtttatcgcacca
gcaatctaccgctctattcataaagcaaccggctttaacagaaatcacatatcatctacg
taa

DBGET integrated database retrieval system