KEGG   Bacillus subtilis subsp. subtilis 168: BSU32040
Entry
BSU32040          CDS       T00010                                 

Symbol
yuiF
Name
(RefSeq) amino acid transporter YuiF
  KO
K07084  putative amino acid transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32040 (yuiF)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU32040 (yuiF)
SSDB
Motif
Pfam: Na_H_antiporter Na_H_antiport_2 CitMHS DctM DcuC
Other DBs
NCBI-GeneID: 937212
NCBI-ProteinID: NP_391084
Pasteur: BG13971
BSORF: BG13971
UniProt: O32105 A0A6M3ZG73
Position
complement(3294942..3296270)
AA seq 442 aa
MNAVVIAVLLMLVLSLLRVNIVIALIIGALAGGLTGGLGLGETVKAFTDGLGGNATVAVS
YAMLGAFAAALTKTGLPDAMVEASVKLIGNKEDSRKKALSKVLIVLIILIVSCFSQNVVP
VHIAFIPVLIPPLLKIFNELEMDRRLIACVITFGLTAPYILLPVGFGQIFQGMLKDNMAD
AGLNVPLADIPYALIIPVAGMVVGLILSVIVYRKPKQYETKDISGAEASPYTRKSIGIAV
LAIVVSLGVQLYLSQTLGVEGMIMGALAGLIVLFVSGVMKRDEADSLITDGMVLMAFIGF
VMLVAAGFSNVLTKTGDVESLVKTSAGFIGHSQSLGALLMLIVGLLITMGIGSSFATIPV
ITTIFVPLCMQLGFSPMATIAIIGAAAALGDAGSPASDSTLGPTSGLSADGQHHHIWDTC
VPTFIFYNIPLVIFGWIAALVL
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgaatgcagtcgtcatcgcagtcctgcttatgcttgtattaagcctgctgcgtgtcaat
attgttatcgcattaattataggcgccttggccggcgggttaacaggcgggctcggtctt
ggcgaaacggttaaagctttcacagacggtctcggcggaaatgccaccgttgcagttagc
tatgccatgcttggcgcgtttgccgccgctttgacgaaaacgggtcttccggacgcaatg
gtggaagcctccgttaaattaatcggaaataaagaagattctcgaaaaaaagcactgtct
aaggtgctgattgtgctgattattttaattgtatcttgtttttcgcaaaacgtcgttccg
gttcacatcgcgtttatcccggtgctgattccgccgcttttgaaaatctttaatgaactt
gaaatggaccgccgtctgatcgcgtgtgtaattacatttggcttaacggctccttatatt
ttgcttccggtcggtttcggccaaatcttccaaggcatgctgaaggacaatatggcggat
gccgggttaaacgttccgcttgctgatattccgtacgcactgattattccagttgcaggt
atggttgtcggccttattttatcagtgatcgtataccgtaaaccgaaacaatatgaaaca
aaagacatttcaggtgcagaagcatcgccatatacgagaaaaagtattggtatcgcggtt
ctagccattgttgtgtcactcggcgtccagctttacttatctcagactttgggagtagaa
ggaatgattatgggggcgctcgctggtctgattgttctgtttgtcagcggtgtgatgaag
cgtgatgaagcggactcactgattactgatggaatggttttaatggcctttatcggcttt
gtcatgcttgttgcagccggattttcaaacgtattgacgaaaaccggagatgtcgagtca
ctggtcaaaacgtcagctggttttatcggacacagtcagtccttgggcgcattgctgatg
ctcattgtcggcttattaattacaatggggatcggatcttcttttgcgaccattcctgtt
atcacaaccattttcgtgcctctatgcatgcagcttggattcagcccgatggcaacgatt
gcgattatcggggctgctgctgcgcttggcgatgccggttcacctgccagtgacagtacg
cttgggccgacttcaggtttgagtgcggacggccagcatcaccacatttgggatacttgt
gtgccgacatttatattttataatattccgcttgtcatctttggctggattgcagcgctt
gttttatag

DBGET integrated database retrieval system