KEGG   Bacillus subtilis subsp. subtilis 168: BSU32040Help
Entry
BSU32040          CDS       T00010                                 

Gene name
yuiF
Definition
(RefSeq) amino acid transporter YuiF
  KO
K07084  putative amino acid transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32040 (yuiF)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU32040 (yuiF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_antiporter Na_H_antiport_2 DctM CitMHS Peptidase_M50
Motif
Other DBs
NCBI-GeneID: 937212
NCBI-ProteinID: NP_391084
Pasteur: BG13971
BSORF: BG13971
UniProt: O32105
Position
complement(3294942..3296270)
Genome map
AA seq 442 aa AA seqDB search
MNAVVIAVLLMLVLSLLRVNIVIALIIGALAGGLTGGLGLGETVKAFTDGLGGNATVAVS
YAMLGAFAAALTKTGLPDAMVEASVKLIGNKEDSRKKALSKVLIVLIILIVSCFSQNVVP
VHIAFIPVLIPPLLKIFNELEMDRRLIACVITFGLTAPYILLPVGFGQIFQGMLKDNMAD
AGLNVPLADIPYALIIPVAGMVVGLILSVIVYRKPKQYETKDISGAEASPYTRKSIGIAV
LAIVVSLGVQLYLSQTLGVEGMIMGALAGLIVLFVSGVMKRDEADSLITDGMVLMAFIGF
VMLVAAGFSNVLTKTGDVESLVKTSAGFIGHSQSLGALLMLIVGLLITMGIGSSFATIPV
ITTIFVPLCMQLGFSPMATIAIIGAAAALGDAGSPASDSTLGPTSGLSADGQHHHIWDTC
VPTFIFYNIPLVIFGWIAALVL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcagtcgtcatcgcagtcctgcttatgcttgtattaagcctgctgcgtgtcaat
attgttatcgcattaattataggcgccttggccggcgggttaacaggcgggctcggtctt
ggcgaaacggttaaagctttcacagacggtctcggcggaaatgccaccgttgcagttagc
tatgccatgcttggcgcgtttgccgccgctttgacgaaaacgggtcttccggacgcaatg
gtggaagcctccgttaaattaatcggaaataaagaagattctcgaaaaaaagcactgtct
aaggtgctgattgtgctgattattttaattgtatcttgtttttcgcaaaacgtcgttccg
gttcacatcgcgtttatcccggtgctgattccgccgcttttgaaaatctttaatgaactt
gaaatggaccgccgtctgatcgcgtgtgtaattacatttggcttaacggctccttatatt
ttgcttccggtcggtttcggccaaatcttccaaggcatgctgaaggacaatatggcggat
gccgggttaaacgttccgcttgctgatattccgtacgcactgattattccagttgcaggt
atggttgtcggccttattttatcagtgatcgtataccgtaaaccgaaacaatatgaaaca
aaagacatttcaggtgcagaagcatcgccatatacgagaaaaagtattggtatcgcggtt
ctagccattgttgtgtcactcggcgtccagctttacttatctcagactttgggagtagaa
ggaatgattatgggggcgctcgctggtctgattgttctgtttgtcagcggtgtgatgaag
cgtgatgaagcggactcactgattactgatggaatggttttaatggcctttatcggcttt
gtcatgcttgttgcagccggattttcaaacgtattgacgaaaaccggagatgtcgagtca
ctggtcaaaacgtcagctggttttatcggacacagtcagtccttgggcgcattgctgatg
ctcattgtcggcttattaattacaatggggatcggatcttcttttgcgaccattcctgtt
atcacaaccattttcgtgcctctatgcatgcagcttggattcagcccgatggcaacgatt
gcgattatcggggctgctgctgcgcttggcgatgccggttcacctgccagtgacagtacg
cttgggccgacttcaggtttgagtgcggacggccagcatcaccacatttgggatacttgt
gtgccgacatttatattttataatattccgcttgtcatctttggctggattgcagcgctt
gttttatag

DBGET integrated database retrieval system