KEGG   Bacillus subtilis subsp. subtilis 168: BSU32050Help
Entry
BSU32050          CDS       T00010                                 

Gene name
yuiE
Definition
(RefSeq) cytosol aminopeptidase
  KO
K01255  leucyl aminopeptidase [EC:3.4.11.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00480  Glutathione metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSU32050 (yuiE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU32050 (yuiE)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     BSU32050 (yuiE)
Peptidases [BR:bsu01002]
 Metallo Peptidases
  Family M17: leucyl aminopeptidase family
   BSU32050 (yuiE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M17 Peptidase_M17_N
Motif
Other DBs
NCBI-GeneID: 936587
NCBI-ProteinID: NP_391085
Pasteur: BG13970
BSORF: BG13970
UniProt: O32106
Position
complement(3296417..3297919)
Genome map
AA seq 500 aa AA seqDB search
MFYAVQQSEHTETLVVGLFQKSQLTGKALEIDEMLEGHLTQLLKEGDVSAKPNQVSKVFP
PSSAGMKRIYFVGLGREANYSFEQAKERFAHVFQAIHKDRKQETAVLLDTFISEDVPPAD
AAHALAESCLLASYEVQDYKHKSNEPDKQIEAVYVVTDEDTQEVQAGLRVGQAYGQGTNS
ARTLVNMPGNMLTATDLASYAEELAAKYDFECEILEKSEMEELGMGGILAVNQGSTEPPK
MIVLKYQGKKEWEDVVGLVGKGITFDTGGYSIKTKSGIVGMKSDMGGAAAVLGAMETIGE
LRPEQNVLCVIPSTDNMISGGAMKPDDVIVSLSGKTIEILNTDAEGRLVLADGITYAKQH
GASVLVDVATLTGGVVVALGTETTGAMTNDQSFYQQVADAAQECGEAIWQLPITEKDKKR
VKSSQMADLSNSPGREGHAIMAGTFLGEFAESTPWVHLDIAGTATANKATCFGPAGATGV
MARTLATLAERFTLEEDKNE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgttttatgcggttcaacaatcagagcatacagaaacccttgttgtcgggctttttcaa
aaaagccagctgacaggaaaagcgttggaaattgatgaaatgctcgaaggccatctgaca
cagcttttaaaagagggtgatgtctctgcgaaaccgaatcaagtatcaaaagtattccct
ccatcttctgcgggtatgaaacggatttatttcgttggcctggggagagaagcaaattat
tcgtttgaacaggcgaaggaacgttttgctcatgtttttcaagccattcataaagatcga
aaacaagaaactgctgttctgcttgatacgtttatttcggaagacgtgcctccagccgat
gccgctcatgctttagctgagagctgcctgcttgcttcctatgaggtgcaggattataag
cataaatcaaatgagcctgacaaacaaattgaagccgtgtatgttgtaacagatgaagat
acacaggaagtgcaggcagggcttcgcgtcggccaggcatacggacaagggacaaattcg
gctagaacgcttgtgaatatgccgggaaacatgctgacagcgactgacctcgcttcgtat
gctgaagagcttgcggcgaaatatgattttgagtgtgagatattggagaaatcagagatg
gaagagctcggtatgggcggaatacttgcggtaaaccaaggctccaccgaaccgccgaaa
atgattgtgttgaaatatcagggcaaaaaggaatgggaagacgtcgtcggactagtcggg
aaaggaattacctttgacacaggcggctactccattaaaacgaaatctggaattgttggc
atgaaatcagatatgggaggagcagctgcggttctcggggctatggaaacgatcggagag
cttcgtcctgaacaaaacgtgctgtgcgttattccatcaaccgataatatgatctccggc
ggggccatgaagccggatgacgtgatcgtatctttaagcggaaaaacaatagaaatcctt
aatacggatgctgaaggaaggctagtgcttgcagatggcattacatacgcgaaacagcat
ggcgcatcagttcttgtcgatgtagctacgcttaccggcggcgtcgttgtggcattagga
acagaaacaaccggtgcaatgacaaatgatcaaagcttttaccagcaggtagctgatgct
gcacaagagtgcggcgaggcgatctggcagctgccgataacagagaaggataaaaaacgc
gtgaaaagcagccaaatggcggatctcagcaattcaccgggacgcgagggacatgcgatt
atggcaggaacgtttcttggtgaattcgctgagtcaacaccttgggttcaccttgatatt
gcaggcacagcgactgccaataaagcaacctgcttcggaccggccggggctactggcgtt
atggcaagaacactggctacacttgcggagcgatttacattggaagaagataaaaacgag
taa

DBGET integrated database retrieval system