KEGG   Bacillus subtilis subsp. subtilis 168: BSU32060Help
Entry
BSU32060          CDS       T00010                                 

Gene name
yuiD
Definition
(RefSeq) hypothetical protein
  KO
K09775  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU32060 (yuiD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF212
Motif
Other DBs
NCBI-GeneID: 936516
NCBI-ProteinID: NP_391086
Pasteur: BG13969
BSORF: BG13969
UniProt: O32107
Position
3298077..3298553
Genome map
AA seq 158 aa AA seqDB search
MELLTNFPLLSSLAAIIFAQVIKVPIQFIVSRKLDWSLVTSTGGMPSSHSAAVTALSTGV
ALEHGLDSSLFAVSAIFAVITMFDATGVRRHAGEQATVINKLVIDFNRFVNEAKDFPKAA
EKEKQKKLKELLGHQPIEVFFGGLTGILLTLVLAYFFM
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggaacttttaacgaattttcctttattatcaagcctggccgcaattatttttgctcag
gtcatcaaagtgcccatacagtttatcgtgtccagaaaactggactggtcgctggtcaca
agcacaggcggcatgcctagctctcactccgcagcggtcactgcgctttctacaggcgta
gccttggagcatggattagactcctcactctttgcggtttccgccattttcgccgtcata
accatgtttgacgcaactggcgtcagacgtcacgccggtgagcaggcaacagtcattaat
aagcttgttattgattttaaccgtttcgtaaatgaagcgaaggacttccctaaggctgca
gagaaagaaaagcaaaaaaagctgaaagagcttctcggacatcagccgatcgaagtcttt
ttcggaggattaacaggtattttactgacattggtactcgcttactttttcatgtaa

DBGET integrated database retrieval system