KEGG   Bacillus subtilis subsp. subtilis 168: BSU32070
Entry
BSU32070          CDS       T00010                                 

Gene name
yuiC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: 3D
Other DBs
NCBI-GeneID: 936601
NCBI-ProteinID: NP_391087
Pasteur: BG13968
BSORF: BG13968
UniProt: O32108 A0A6M3ZFP7
Structure
PDB: 
4WJT 4WLI 4WLK

Position
complement(3298584..3299240)
AA seq 218 aa
MMLNMIRRLLMTCLFLLAFGTTFLSVSGIEAKDLSKWVQEHQEKHLKHAGLRLKALQQKQ
TQTTSAAEDKTKPLEEAFDWDEYPVQRVTATGYTAGAESTGKNPGDPLYGLTYSGVKVKR
DLYSTVAADPSVFPIGTILFIPNYGLGVVADTGSAIKGNRLDLYFETVKDVYNEWGKKTL
DVYVIKKGTGKITEDELEKLNETKSLQVFRNQYKTVKE
NT seq 657 nt   +upstreamnt  +downstreamnt
atgatgttgaatatgatcagacgtttgctgatgacctgtttatttctgcttgcatttggc
acgacatttttatcagtgtcaggaattgaagcgaaggacttgtcaaaatgggtgcaggaa
catcaggaaaagcacttgaagcatgcaggactgagattaaaagcattgcagcagaaacaa
acacaaaccacgtccgcggctgaggataaaacaaaaccgttagaagaggcatttgattgg
gatgaatatccagtccaaagagtaacagcaacaggctacacagcaggagctgagtcgacg
ggcaaaaatcccggtgatccattatacgggcttacatattcaggtgtgaaagtgaaacgg
gatttatattccacggttgctgctgacccgtccgttttcccgatcggaacaattttattc
attccgaactacggtctcggagttgtggccgacacaggatcagctattaagggaaaccgc
cttgatctgtactttgagacagtcaaagatgtatacaatgaatggggcaaaaaaaccctt
gatgtatatgtgattaaaaagggaacgggaaagattaccgaggatgagcttgagaagctc
aatgaaacaaaatctttgcaagtgttcagaaatcaatataaaacggtgaaagaataa

DBGET integrated database retrieval system