KEGG   Bacillus subtilis subsp. subtilis 168: BSU32070Help
Entry
BSU32070          CDS       T00010                                 

Gene name
yuiC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3D
Motif
Other DBs
NCBI-GeneID: 936601
NCBI-ProteinID: NP_391087
Pasteur: BG13968
BSORF: BG13968
UniProt: O32108
Structure
PDB: 

Position
complement(3298584..3299240)
Genome map
AA seq 218 aa AA seqDB search
MMLNMIRRLLMTCLFLLAFGTTFLSVSGIEAKDLSKWVQEHQEKHLKHAGLRLKALQQKQ
TQTTSAAEDKTKPLEEAFDWDEYPVQRVTATGYTAGAESTGKNPGDPLYGLTYSGVKVKR
DLYSTVAADPSVFPIGTILFIPNYGLGVVADTGSAIKGNRLDLYFETVKDVYNEWGKKTL
DVYVIKKGTGKITEDELEKLNETKSLQVFRNQYKTVKE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgatgttgaatatgatcagacgtttgctgatgacctgtttatttctgcttgcatttggc
acgacatttttatcagtgtcaggaattgaagcgaaggacttgtcaaaatgggtgcaggaa
catcaggaaaagcacttgaagcatgcaggactgagattaaaagcattgcagcagaaacaa
acacaaaccacgtccgcggctgaggataaaacaaaaccgttagaagaggcatttgattgg
gatgaatatccagtccaaagagtaacagcaacaggctacacagcaggagctgagtcgacg
ggcaaaaatcccggtgatccattatacgggcttacatattcaggtgtgaaagtgaaacgg
gatttatattccacggttgctgctgacccgtccgttttcccgatcggaacaattttattc
attccgaactacggtctcggagttgtggccgacacaggatcagctattaagggaaaccgc
cttgatctgtactttgagacagtcaaagatgtatacaatgaatggggcaaaaaaaccctt
gatgtatatgtgattaaaaagggaacgggaaagattaccgaggatgagcttgagaagctc
aatgaaacaaaatctttgcaagtgttcagaaatcaatataaaacggtgaaagaataa

DBGET integrated database retrieval system