KEGG   Bacillus subtilis subsp. subtilis 168: BSU32080
Entry
BSU32080          CDS       T00010                                 

Gene name
yuiB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YuiB
Other DBs
NCBI-GeneID: 938035
NCBI-ProteinID: NP_391088
Pasteur: BG13967
BSORF: BG13967
UniProt: O32109 A0A6M3ZG74
Position
complement(3299344..3299664)
AA seq 106 aa
MISLPVVIISIVLFFVLFFGIGFLLNMLLRMSWIMAVIYPIVCLFIISKEKLISYVQSPG
ESFASLFHRVLSLAAADVLILVSGLAGAIVSGIAINMLRKRGYQMF
NT seq 321 nt   +upstreamnt  +downstreamnt
ttgattagtctgccagtcgtaatcatctcaattgttttgttttttgtcttgttttttgga
atcggtttcttattaaacatgctgctgagaatgtcttggattatggctgtgatttatcca
attgtatgccttttcattatcagcaaagaaaagctgatcagctatgtccagtcgccggga
gaatcctttgccagcctgtttcatcgtgtcttatcattagcggctgctgatgtgctgatt
ttagtcagcggtttggccggcgccatcgtgtccggtatagcgatcaacatgcttagaaaa
agaggatatcaaatgttttaa

DBGET integrated database retrieval system