KEGG   Bacillus subtilis subsp. subtilis 168: BSU32100
Entry
BSU32100          CDS       T00010                                 

Gene name
yumB
Definition
(RefSeq) NADH dehydrogenase-like protein YumB
  KO
K03885  NADH:ubiquinone reductase (H+-translocating) [EC:7.1.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU32100 (yumB)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     BSU32100 (yumB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox NAD_binding_9 DAO Pyr_redox_3 NAD_binding_8
Other DBs
NCBI-GeneID: 937062
NCBI-ProteinID: NP_391090
Pasteur: BG12390
BSORF: BG12390
UniProt: O05267
Position
complement(3300034..3301254)
AA seq 406 aa
MALNKPKIVILGAGYGGLMTVTRLTKYVGPNDADITLVNKHNYHYETTWMHEASAGTLHH
DRCRYQIKDVINQSRVNFVQDTVKAIKIDEKKVVLANGELQYDYLVIGLGAVPETFGIKG
LKEYAFPIANINTSRLLREHIELQFATYNTEAEKRPDRLTIVVGGAGFTGIEFLGELAAR
VPELCKEYDVDRSLVRIICVEAAPTVLPGFDPELVDYAVHYLEENGVEFKIGTAVQECTP
EGVRVGKKDEEPEQIKSQTVVWAAGVRGHPIVEEAGFENMRGRVKVNPDLRAPGHDNVFI
LGDSSLFMNEDTERPYPPTAQIAMQQGITVAKNLGRLIKGGELEEFKPDIKGTVASLGEH
NAVGVVYGRKLKGTPASFMKKVIDNRSLFMIGGLGLTLKKGKFKFF
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcattgaataagcccaaaatcgtgattttaggtgcaggatatggcggattgatgacg
gtgacaaggctgacgaagtatgtcgggccgaatgatgctgacattacgcttgtaaataaa
cacaattatcattatgaaacgacatggatgcatgaagcgagcgcgggtacgctccatcat
gaccgctgccgttatcagataaaagatgtaatcaaccagtcacgggtgaattttgtacag
gataccgtaaaggcaatcaaaattgatgagaaaaaagttgtgcttgcgaatggagaattg
cagtacgattatttagtcatcgggctcggcgccgtgcctgaaacgttcggcattaaaggc
ttaaaagaatatgcgtttccgattgccaacatcaacacgtcgcgcctgctgcgggaacat
attgagctgcagtttgcgacttacaatacggaagcggaaaaacggccggacaggttaacg
atcgttgttggcggtgccggatttacgggaattgaatttcttggcgaactggctgctcgc
gtgccggagctctgtaaggaatatgacgttgacagaagccttgtccgcatcatttgtgtg
gaagcagcgccgaccgttttgccgggctttgatccggaacttgttgattacgccgtacat
tatcttgaggaaaacggagttgagttcaagatcggaacggctgtacaagaatgtacacca
gaaggagtcagagtcggcaaaaaagatgaagaaccagagcagatcaaatcgcaaaccgtt
gtatgggcggcaggtgtccgcggccatccgattgtggaggaagccggttttgagaatatg
cgcggccgagtcaaagtcaaccctgatctccgcgccccgggacatgacaatgtctttatt
ctcggcgacagctcgctgtttatgaatgaagatacagagcgcccgtatccgccgactgcg
caaattgcaatgcagcagggcataacggtcgctaaaaaccttggcaggcttattaaaggc
ggagagcttgaggaattcaagccggacattaagggaacagtggcttctcttggcgagcat
aacgcggttggggttgtttatggcagaaagctgaaaggcacgcccgcttcgtttatgaaa
aaagtcattgataaccgctcactgtttatgattggcggactcggactgacattgaaaaaa
ggcaagttcaagtttttctaa

DBGET integrated database retrieval system