KEGG   Bacillus subtilis subsp. subtilis 168: BSU32110Help
Entry
BSU32110          CDS       T00010                                 

Gene name
yumC
Definition
(RefSeq) ferredoxin--NADP reductase 2
  KO
K21567  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU32110 (yumC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     BSU32110 (yumC)
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     BSU32110 (yumC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like K_oxygenase DAO NAD_binding_8 FAD_oxidored GIDA Thi4 Peptidase_C69 FMO-like Oxidored_nitro
Motif
Other DBs
NCBI-GeneID: 936577
NCBI-ProteinID: NP_391091
Pasteur: BG12391
BSORF: BG12391
UniProt: O05268
Structure
PDB: 

Position
3301586..3302584
Genome map
AA seq 332 aa AA seqDB search
MREDTKVYDITIIGGGPVGLFTAFYGGMRQASVKIIESLPQLGGQLSALYPEKYIYDVAG
FPKIRAQELINNLKEQMAKFDQTICLEQAVESVEKQADGVFKLVTNEETHYSKTVIITAG
NGAFKPRKLELENAEQYEGKNLHYFVDDLQKFAGRRVAILGGGDSAVDWALMLEPIAKEV
SIIHRRDKFRAHEHSVENLHASKVNVLTPFVPAELIGEDKIEQLVLEEVKGDRKEILEID
DLIVNYGFVSSLGPIKNWGLDIEKNSIVVKSTMETNIEGFFAAGDICTYEGKVNLIASGF
GEAPTAVNNAKAYMDPKARVQPLHSTSLFENK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcgagaggatacaaaggtttatgatattacaattataggcgggggaccggtcggctta
ttcaccgctttttacggcgggatgagacaggcaagcgtcaaaattatcgaaagcctgcct
cagctcggcggacagcttagcgccctataccctgagaagtatatatatgatgtagcggga
ttcccgaaaatccgcgcgcaagagcttatcaataacctaaaagagcaaatggcgaaattc
gaccaaaccatttgtctggagcaagcggttgaatctgttgagaaacaagcggacggcgtg
tttaagcttgtaacaaatgaagaaacccactactctaaaacggtcatcataactgcagga
aacggcgcattcaaaccgagaaagctggaacttgaaaatgccgagcagtatgaaggcaaa
aacctccattacttcgttgatgatctgcaaaaattcgccggcagacgcgttgcgatcctt
ggcggtggagattccgcggttgactgggcgcttatgcttgagccaatcgcaaaagaagta
tcgatcattcaccgccgcgacaagttccgagcgcacgagcacagtgtggaaaaccttcat
gcgtcgaaggttaatgtcctgacaccattcgtccctgcggagctgatcggcgaagacaaa
atcgaacagctagtgcttgaagaagtgaaaggcgaccgcaaagagattttagaaattgat
gacttaatcgtcaactacggtttcgtttcatctcttggaccgatcaaaaactggggcctg
gacatcgagaaaaattccattgtcgtgaaatcaacaatggaaacaaatatcgaaggcttc
tttgcagcaggtgacatttgtacatacgaaggaaaagtcaacctgattgccagcggcttc
ggcgaggcaccgacagcagtgaacaacgccaaggcttacatggacccgaaagcccgcgta
cagcctcttcactcaacaagtctttttgaaaataaataa

DBGET integrated database retrieval system