KEGG   Bacillus subtilis subsp. subtilis 168: BSU32120Help
Entry
BSU32120          CDS       T00010                                 

Gene name
yuzG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 936597
NCBI-ProteinID: NP_391092
Pasteur: BG14056
BSORF: BG14056
UniProt: O32111
Position
complement(3302623..3302763)
Genome map
AA seq 46 aa AA seqDB search
MAQNEEKTPKSQKIQDRIIMAMIWVVAALVIALVVGTALNYINIFK
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaaacgaagaaaaaacaccgaagtcccaaaagattcaggaccgcattattatg
gcaatgatctgggtagtcgcagcccttgtgattgcgctggttgtaggaactgcattgaat
tatataaatatcttcaaataa

DBGET integrated database retrieval system