KEGG   Bacillus subtilis subsp. subtilis 168: BSU32140
Entry
BSU32140          CDS       T00010                                 

Gene name
paiB
Definition
(RefSeq) protease synthase and sporulation protein PAI 2
  KO
K07734  transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU32140 (paiB)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Other transcription factors
   Others
    BSU32140 (paiB)
SSDB
Motif
Pfam: FMN_bind_2 Pyridox_ox_2 Putative_PNPOx
Other DBs
NCBI-GeneID: 936588
NCBI-ProteinID: NP_391094
Pasteur: BG10696
BSORF: BG10696
UniProt: P21341 A0A6M4JMY1
Position
complement(3304096..3304719)
AA seq 207 aa
MYIPKYFKVTNAEEIWNFVQENSFGTVVTTEQGKPIATHLPLGFNKKDDHYYITGHFAYG
NPQWRTFEACEDVLVMFQGPHAYISSSWYSRENVPTWNYQAVHMYGKASMLEKDELAEEL
TIMLEKYEKHRDNPVLWDKLSPKLLESELKGIVGFKIKVEDIQAAYKLSQNRNETDYMNV
IEQLQNEENPNAKQMAELMEDKLKKQI
NT seq 624 nt   +upstreamnt  +downstreamnt
atgtatattccaaaatattttaaagtcacaaatgctgaagaaatttggaattttgtacaa
gaaaactcctttggtacggttgtcacaacagaacaaggaaaaccaattgccacacatttg
ccgttaggattcaataaaaaagacgatcattactatattacggggcatttcgcttatgga
aatcctcagtggagaacgtttgaagcctgtgaagatgtgcttgtgatgtttcagggaccg
cacgcttatatttcttcttcctggtattcgcgcgaaaatgttccgacgtggaattatcag
gctgtccacatgtatggaaaagcaagtatgttagagaaagatgaattagcagaagaatta
acaatcatgttggagaaatacgaaaaacatcgtgacaatcctgtgttatgggataagctt
tctccaaaactcttagaaagtgaattgaaaggtattgttggatttaagattaaggtggaa
gacattcaagcggcatataaattaagccagaaccgaaatgaaacggattatatgaacgtc
attgaacagttgcaaaatgaagaaaatccaaatgcaaaacaaatggcagaactgatggaa
gataaactcaaaaagcaaatataa

DBGET integrated database retrieval system