KEGG   Bacillus subtilis subsp. subtilis 168: BSU32150Help
Entry
BSU32150          CDS       T00010                                 

Gene name
paiA
Definition
(RefSeq) protease synthase and sporulation negative regulatory protein PAI 1
  KO
K22441  diamine N-acetyltransferase [EC:2.3.1.57]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU32150 (paiA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.57  diamine N-acetyltransferase
     BSU32150 (paiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_4 FR47 Acetyltransf_3 Acetyltransf_15 Acetyltransf_CG Acetyltransf_8 Acetyltransf_16 GNAT_acetyltran Acetyltransf_9 Acetyltransf_13
Motif
Other DBs
NCBI-GeneID: 937204
NCBI-ProteinID: NP_391095
Pasteur: BG10695
BSORF: BG10695
UniProt: P21340
Structure
PDB: 

Position
complement(3304743..3305261)
Genome map
AA seq 172 aa AA seqDB search
MSVKMKKCSREDLQTLQQLSIETFNDTFKEQNSPENMKAYLESAFNTEQLEKELSNMSSQ
FFFIYFDHEIAGYVKVNIDDAQSEEMGAESLEIERIYIKNSFQKHGLGKHLLNKAIEIAL
ERNKKNIWLGVWEKNENAIAFYKKMGFVQTGAHSFYMGDEEQTDLIMAKTLI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaaaaatgaaaaaatgcagccgggaagatttacaaacacttcaacaattgagt
attgaaacattcaatgacacttttaaagaacagaactcacctgaaaatatgaaagcctat
ttagaaagcgcatttaacactgagcagctggaaaaagagttatctaatatgtcttcgcaa
ttcttttttatttactttgatcatgaaatcgctggatatgtaaaggtcaatatcgatgat
gctcagtctgaagaaatgggtgctgaatcacttgaaatcgagagaatttatataaagaac
agctttcaaaaacatgggcttggcaaacatctgctgaataaagcgatagaaattgcgctg
gaacgtaataaaaagaacatttggctaggtgtgtgggaaaaaaatgaaaatgccattgcc
ttttataagaaaatggggtttgttcagaccggcgcccactcattttatatgggtgatgaa
gaacaaacggatttaatcatggctaaaacactcatataa

DBGET integrated database retrieval system