KEGG   Bacillus subtilis subsp. subtilis 168: BSU32160Help
Entry
BSU32160          CDS       T00010                                 

Gene name
yutM
Definition
(RefSeq) hypothetical protein
  KO
K13628  iron-sulfur cluster assembly protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsu03016]
    BSU32160 (yutM)
Transfer RNA biogenesis [BR:bsu03016]
 Prokaryotic Type
  tRNA modification factors
   Thiolation factors
    BSU32160 (yutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-S_biosyn
Motif
Other DBs
NCBI-GeneID: 936627
NCBI-ProteinID: NP_391096
Pasteur: BG14049
BSORF: BG14049
UniProt: O32113
Position
complement(3305599..3305961)
Genome map
AA seq 120 aa AA seqDB search
MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKSESDSVFDQ
HGITVLVDKESLDIMNGTVIDYKQSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKPEEC
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacccggtaacaattacagaagcagcagctttgcatataaaagatatgatgaaa
gagcatgaagaagaaaacgcgtttctgcgtgtaggcgtcaaaggcggcggctgcagcgga
ctttcttacggcatgggctttgagcatgaaaagagtgaatcagacagtgtgtttgatcag
cacggcatcactgttctagttgacaaagaaagccttgacatcatgaacggcaccgtgatt
gattataaacaatccatgctcggcggcggcttcaccatcgacaatccaaacgccatcgct
tcatgcggctgcggttcttcgttcagaacagcaacgaatgcaggcaagcctgaagagtgc
taa

DBGET integrated database retrieval system