KEGG   Bacillus subtilis subsp. subtilis 168: BSU32170Help
Entry
BSU32170          CDS       T00010                                 

Gene name
dapF
Definition
(RefSeq) diaminopimelate epimerase
  KO
K01778  diaminopimelate epimerase [EC:5.1.1.7]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00300  Lysine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01230  Biosynthesis of amino acids
Module
bsu_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    BSU32170 (dapF)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     BSU32170 (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAP_epimerase PhzC-PhzF Pro_racemase
Motif
Other DBs
NCBI-GeneID: 937110
NCBI-ProteinID: NP_391097
Pasteur: BG14048
BSORF: BG14048
UniProt: O32114
Position
complement(3306040..3306894)
Genome map
AA seq 284 aa AA seqDB search
MNSFRFTKMHGLGNSYIYVNQFEEQLPEEKLSEIAIQVSSVYTGIGSDGMILICPSDQAP
VKMRIFNNDGSEGKNCGNGLRCVAKYAYEHKLVEETSFLIETLSGLVKAEVQVENGKVNV
VTVDMGEPRLTKSELPMLDGGEEHTINETMAFGEVELTGTAVSMGNPHIVFPIADIEQAP
LTTLGPVIEKDPRFPEGINVEFVETVNEQELHFRVWERGSGITQACGTGACAAAVASVLN
GVSKRNQDITVHLAGGDLVINWKDNGHVMMTGPAETVCEGVYFL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaactcatttcgatttaccaaaatgcacggcctgggaaacagttatatttatgtgaat
caatttgaagaacagcttccagaagaaaaactgtcagagattgcaattcaggtttcttct
gtttatacagggatcggatccgacggaatgatcctgatatgcccatcagaccaagcgcct
gttaaaatgcggatttttaataatgacgggtctgaagggaaaaactgcggcaacggcctg
cgctgcgtcgcaaaatacgcatatgagcataagctggttgaggaaacatcttttctgatt
gaaactctctccgggcttgtgaaagcggaggttcaagtcgaaaacggaaaagtgaatgtg
gtcactgtcgatatgggcgaaccgcgcttgacaaaatccgagcttcctatgcttgacggc
ggggaagagcacacaatcaatgaaacgatggcatttggtgaagtagaactaacaggcact
gccgtttcaatgggaaatccgcatatcgtttttccgatcgcagacattgaacaggcaccc
ttaacgacactggggccggtgattgagaaagatccgagatttccggaaggcatcaatgtg
gaattcgttgaaaccgtgaatgaacaagaattgcatttccgcgtctgggaacggggatca
gggattactcaggcatgcgggacaggagcatgtgcagcggcagtcgcatctgtattaaac
ggcgtatcaaagcgaaatcaagacatcacggtgcatttagcaggcggggatttggtgata
aactggaaagataacggccatgtaatgatgacagggccggctgaaaccgtttgtgagggt
gtctatttcttgtaa

DBGET integrated database retrieval system