KEGG   Bacillus subtilis subsp. subtilis 168: BSU32180Help
Entry
BSU32180          CDS       T00010                                 

Gene name
yutK
Definition
(RefSeq) transporter
  KO
K03317  concentrative nucleoside transporter, CNT family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BSU32180 (yutK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nucleos_tra2_C Nucleos_tra2_N Gate Herpes_UL49_5
Motif
Other DBs
NCBI-GeneID: 936517
NCBI-ProteinID: NP_391098
Pasteur: BG14047
BSORF: BG14047
UniProt: O32115
Position
complement(3307017..3308231)
Genome map
AA seq 404 aa AA seqDB search
MNVLWGLLGAVAIIAIAFLFSEKKSNIKIRTVIVGLCTQVAFGYIVLKWEAGRAVFLWFS
SRVQLLIDYANEGISFIFGPLLKVGDSPAFALSVLPVIIFFSALIAVLYHLKIMQLVFRV
IGGGLSKLLGTSKTESLAAAANIFVGQSESPLVIKPLIAGLTRSELFTIMTSGLSAVAGS
TLFGYALLGIPIEYLLAASFMAAPAGLVFGKLIIPETEKTQTVKSDFKMDEGEGAANVID
AAAKGASTGLQIALNVGAMLLAFVALIAVVNGILGGAFGLFGLKGVTLESILGYVFSPIA
FLIGVPWHEALQAGSYIGQKLVLNEFVAYSNFGSHIGEFSKKTATIISFALCGFANFSSI
AIMLGTLGGLAPSRRSDIARLGLKAVLAGTLANLLSAAIAGMFI
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttctgtgggggctgctgggcgcagttgcgatcattgctatcgcgtttttattt
tcagaaaagaaaagcaatattaagataagaaccgtcatcgttggtttatgcacacaggtg
gcgtttggatacatcgtgttgaaatgggaagcgggacgcgctgtttttttatggttttca
agccgtgtacagcttctgattgactatgcgaatgaaggcatcagttttatttttggaccg
cttctaaaggtcggagacagtccggcatttgcattaagtgtactgcccgttatcattttc
ttctcagcactgattgcagttttatatcatttgaaaatcatgcagctcgttttccgtgtc
attggcggcggattgtcgaagctccttggaacaagcaaaacggaatctctggcggctgct
gccaatatttttgtaggacaatcagaatctccgttagtgatcaaacccctgattgccggg
ctgacgcgctctgagttgtttacgattatgacgagcggtctatcggcagttgcgggatct
accttgtttgggtacgcgcttctcggtattccgattgagtacttgctggcggccagcttt
atggctgctccagctggactagtctttggtaaattgattatacccgaaacggaaaaaacg
caaaccgtaaaaagcgatttcaaaatggatgaaggcgaaggcgcagccaatgtcattgac
gcagctgcaaagggagcgtcaacaggactgcaaattgcgttaaatgttggggcgatgctg
cttgcgtttgttgcgttaatcgctgtagtaaacggtattctcggcggggctttcggcttg
ttcggtttaaaaggcgtaacattagaatccattctcggctatgtgttttctcctatcgcc
tttttgattggcgtgccttggcatgaagcattgcaggcgggaagctatatcggccagaaa
ttggtgctgaatgagtttgtcgcttattctaacttcggttcgcacatcggcgagttttct
aagaaaactgctaccattatcagtttcgcgttatgcggattcgccaatttttcatcaatt
gcgattatgcttggtacgcttggcggtttagcgcccagccgccgttcagatatcgcacgt
ctcggcctgaaggctgttcttgcaggaacattagccaatctgctcagcgcagccattgcc
ggcatgtttatataa

DBGET integrated database retrieval system