KEGG   Bacillus subtilis subsp. subtilis 168: BSU32190
Entry
BSU32190          CDS       T00010                                 

Gene name
yuzB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1450 Sigma54_AID
Other DBs
NCBI-GeneID: 936585
NCBI-ProteinID: NP_391099
Pasteur: BG14051
BSORF: BG14051
UniProt: O32116 A0A6M3ZGJ0
Position
complement(3308368..3308604)
AA seq 78 aa
MNPMIEFCVSNLAHGSQEARAILEKDPNLDVLEYGCLSYCGTCMESLFALVNGEVVMGET
PAELVENIYTFIEENPMF
NT seq 237 nt   +upstreamnt  +downstreamnt
atgaatccaatgattgaattttgtgtcagcaatctggctcacggctctcaggaagcccgg
gcgattttggagaaggatcccaaccttgatgtccttgaatatggctgcttaagctactgc
gggacatgtatggaatcgcttttcgctctggtaaacggagaagtcgtcatgggtgaaacg
cctgctgagcttgttgagaatatatatacctttattgaagaaaatccaatgttttaa

DBGET integrated database retrieval system