KEGG   Bacillus subtilis subsp. subtilis 168: BSU32200
Entry
BSU32200          CDS       T00010                                 

Gene name
yutJ
Definition
(RefSeq) NADH dehydrogenase-like protein YutJ
  KO
K03885  NADH:ubiquinone reductase (H+-translocating) [EC:7.1.1.2]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BSU32200 (yutJ)
Enzymes [BR:bsu01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     BSU32200 (yutJ)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox DAO NAD_binding_9 Pyr_redox_3 K_oxygenase NAD_binding_8 Lycopene_cycl
Other DBs
NCBI-GeneID: 936600
NCBI-ProteinID: NP_391100
Pasteur: BG14046
BSORF: BG14046
UniProt: O32117 A0A6M4JNW1
Position
3308867..3309934
AA seq 355 aa
MKKLVLIGGGYGNMRVLHRLLPNQLPDDVSITLIDRNPYHCLKTEYYALAAGTISDHHIR
VSFPEHPRLDVQYGDITSIDIVQKQVLFQDREPISYDDAIIGLGCEDKYHNVPGAPEFTY
SIQTIDQSRETYQKLNNLSANATVAIVGAGLSGVELASELRESRDDLNIILFDRGNLILS
SFPERLSKYVQKWFEEHGVRIINRANITKVEEGVVYNHDDPISADAIVWTAGIQPNKVVR
DLDVEKDAQGRIVLTPHHNLPGDEHLYVVGDCASLPHAPSAQLAEAQAEQIVQILQKRWN
GEALPESMPQFKLKGVLGSLGKKAGFGLVADRPLIGRVPRMLKSGLLWMYKHHNG
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgaaaaaattggtcttgatcggcggaggttacgggaacatgcgcgttcttcatcgctta
ttgccaaaccagctgcctgatgatgtttcaatcacgttaattgacagaaatccttatcac
tgcttgaaaacagaatattatgcccttgccgcaggcacaatttctgaccatcatatcaga
gtgtcattcccagagcaccctcgcctggatgtccaatacggtgatatcacatcaattgat
attgtacaaaaacaagtgctgttccaagatcgtgaaccgatttcttacgatgacgccata
atcgggctcggctgtgaggataaatatcacaacgtgccgggagcgcctgaattcacctac
agtattcaaaccatcgatcagtcccgcgaaacctaccaaaagctgaataatctgagcgct
aatgccaccgtcgccattgtcggagcgggcttaagcggcgttgagcttgcaagtgaattg
agagaaagccgtgatgacctgaacattattttgttcgaccgcggtaatctcattttatca
agctttcccgagcgtttaagcaaatatgtgcaaaaatggttcgaagagcacggtgtccgc
attattaacagggcaaatatcacaaaagtagaagaaggcgttgtgtataaccacgatgat
ccgatttctgcagacgccatcgtgtggacagccggcatccagccaaacaaagtcgtcaga
gacttagatgtggagaaggacgcacaagggcgtattgtattaacgcctcatcataatctt
ccaggtgatgaacatctgtacgttgtcggcgattgcgccagtcttcctcatgcaccgagc
gcccagctggcagaggctcaagcagagcagattgtccaaatcttgcaaaaacgctggaat
ggagaagccctgcctgaatcaatgccgcagtttaagctgaaaggcgtcctcggttcactc
ggaaaaaaagccggcttcgggcttgttgctgaccgtccgctgatcggccgtgttccgcgt
atgctgaaatccggcttgctgtggatgtataaacaccataacggttaa

DBGET integrated database retrieval system