KEGG   Bacillus subtilis subsp. subtilis 168: BSU32210
Entry
BSU32210          CDS       T00010                                 

Gene name
yuzD
Definition
(RefSeq) disulfide oxidoreductase YuzD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1462
Other DBs
NCBI-GeneID: 937202
NCBI-ProteinID: NP_391101
Pasteur: BG14053
BSORF: BG14053
UniProt: O32118 A0A6M3ZG87
Position
complement(3309960..3310286)
AA seq 108 aa
MMKPVMLSVYGAENVCASCVNMPTAKDTYEWLEAALKRKYPNQPFEMQYIDIHEPPDNEH
AKELAEKIRNDEYFYPLVLVEDKIVGEGNPKLKDVYEEMEKHGYTENR
NT seq 327 nt   +upstreamnt  +downstreamnt
gtgatgaaaccagtcatgctaagcgtgtacggggcagaaaacgtttgtgcgagctgtgta
aatatgccgacagccaaggatacatacgagtggcttgaggctgcgctgaaaagaaaatat
ccaaatcagccttttgagatgcagtacatcgatattcatgagccgcctgacaatgaacat
gcgaaagagcttgcggaaaaaatcagaaatgacgagtatttttatccgcttgtgcttgta
gaagacaaaattgtcggtgaaggcaatccaaaattaaaagacgtttatgaggaaatggag
aagcatgggtatacagaaaaccgctga

DBGET integrated database retrieval system