KEGG   Bacillus subtilis subsp. subtilis 168: BSU32210Help
Entry
BSU32210          CDS       T00010                                 

Gene name
yuzD
Definition
(RefSeq) disulfide oxidoreductase YuzD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1462
Motif
Other DBs
NCBI-GeneID: 937202
NCBI-ProteinID: NP_391101
Pasteur: BG14053
BSORF: BG14053
UniProt: O32118
Position
complement(3309960..3310286)
Genome map
AA seq 108 aa AA seqDB search
MMKPVMLSVYGAENVCASCVNMPTAKDTYEWLEAALKRKYPNQPFEMQYIDIHEPPDNEH
AKELAEKIRNDEYFYPLVLVEDKIVGEGNPKLKDVYEEMEKHGYTENR
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaccagtcatgctaagcgtgtacggggcagaaaacgtttgtgcgagctgtgta
aatatgccgacagccaaggatacatacgagtggcttgaggctgcgctgaaaagaaaatat
ccaaatcagccttttgagatgcagtacatcgatattcatgagccgcctgacaatgaacat
gcgaaagagcttgcggaaaaaatcagaaatgacgagtatttttatccgcttgtgcttgta
gaagacaaaattgtcggtgaaggcaatccaaaattaaaagacgtttatgaggaaatggag
aagcatgggtatacagaaaaccgctga

DBGET integrated database retrieval system