KEGG   Bacillus subtilis subsp. subtilis 168: BSU32220Help
Entry
BSU32220          CDS       T00010                                 

Gene name
yutI
Definition
(RefSeq) nitrogen fixation protein YutI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NifU
Motif
Other DBs
NCBI-GeneID: 936658
NCBI-ProteinID: NP_391102
Pasteur: BG14045
BSORF: BG14045
UniProt: O32119
Position
3310386..3310721
Genome map
AA seq 111 aa AA seqDB search
MCYNRESNFANQTIDFYCYTEYNGFMTTKGANVMTEVEMKEQVQEVLDKLRPFLLRDGGD
CELVDVDEGIVKLRLLGACGSCPSSTITLKAGIERALLEEVPGVVEVEQVF
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtgctataatagggaaagcaactttgcaaaccaaacaatagatttttattgttacact
gaatataatggttttatgacgacgaaaggagcgaatgtcatgactgaagttgaaatgaaa
gaacaggtgcaggaagtactggacaaacttcgtccgtttttacttcgtgacggcggtgac
tgtgagcttgtagacgtagatgaaggtatcgttaagcttcgtcttctaggcgcatgcggc
agctgcccaagttcaacaattacgttgaaagccggaattgagcgcgctcttcttgaagaa
gtgccgggtgtcgttgaagtagaacaagtcttttaa

DBGET integrated database retrieval system