KEGG   Bacillus subtilis subsp. subtilis 168: BSU32240Help
Entry
BSU32240          CDS       T00010                                 

Gene name
thrB
Definition
(RefSeq) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01230  Biosynthesis of amino acids
Module
bsu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU32240 (thrB)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     BSU32240 (thrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 936665
NCBI-ProteinID: NP_391104
Pasteur: BG10462
BSORF: BG10462
UniProt: P04948
Position
complement(3312844..3313773)
Genome map
AA seq 309 aa AA seqDB search
MNEADMLFSVTVPGSTANLGPGFDSVGMALSRYLKLTVFESDKWSFEAETETVAGIPAGT
DNLIYQVAKRTADLYGKEMPPVHVKVWSDIPLARGLGSSAAAIVAAIELADELCGLKLSE
ADKLHLASLEEGHPDNAGASLVGGLVIGLHEDDETQMIRVPNADIDVVVVIPFYEVLTRD
ARDVLPKEFPYADAVKASAVSNILIAAIMSKDWPLVGKIMKKDMFHQPYRAMLVPELSKV
EHVAEMKGAYGTALSGAGPTILVMTEKGKGEELKEQLALHFPHCEVDALTVPKEGSIIER
NPLYQVKSV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagccgacatgctgttctctgtcactgttcccggaagcacagctaacctaggc
cccggctttgattcagtcggaatggcgctcagcagatatttgaagctgaccgtctttgaa
agcgacaaatggtcttttgaggctgaaacagaaacagtcgccggaattccggcgggtaca
gataacctgatctaccaagtggctaaacggaccgcagatttgtacggaaaagaaatgcct
cctgtccatgtgaaggtgtggagcgacatcccgcttgcacgcggccttggcagcagcgcc
gcagcgattgtagcggccattgaactggctgatgaattatgcggcttaaagctgtctgaa
gcggacaagctgcatttagcgagtctagaagaaggacacccggacaatgctggcgcttct
ctcgtcggcggacttgtgatcggcctgcatgaggatgacgagacccaaatgatccgcgtc
ccgaatgctgacattgacgtagtcgttgtcattcctttttatgaagtgctgacaagagac
gcgagagacgtgcttccgaaggagtttccatatgccgatgccgtaaaagcaagtgctgtc
agcaatatcctcattgctgcgatcatgtccaaggattggccgcttgtcgggaaaatcatg
aagaaggatatgttccatcagccgtaccgggcgatgcttgtgcctgagctgtcaaaagta
gagcacgtcgccgagatgaagggcgcatatggaacggctctcagcggagcaggcccaacg
attctcgtcatgaccgaaaaaggaaagggagaagagctaaaagaacagctcgcgcttcat
ttccctcattgtgaagtagacgctttgaccgttccgaaagagggaagtataatagagcga
aatcctttatatcaagtaaaaagtgtatag

DBGET integrated database retrieval system