KEGG   Bacillus subtilis subsp. subtilis 168: BSU32250Help
Entry
BSU32250          CDS       T00010                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00750  Vitamin B6 metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01230  Biosynthesis of amino acids
Module
bsu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU32250 (thrC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    BSU32250 (thrC)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     BSU32250 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 936660
NCBI-ProteinID: NP_391105
Pasteur: BG10461
BSORF: BG10461
UniProt: P04990
Structure
PDB: 

Position
complement(3313770..3314828)
Genome map
AA seq 352 aa AA seqDB search
MWKGLIHQYKEFLPVTDQTPALTLHEGNTPLIHLPKLSEQLGIELHVKTEGVNPTGSFKD
RGMVMAVAKAKEEGNDTIMCASTGNTSAAAAAYAARANMKCIVIIPNGKIAFGKLAQAVM
YGAEIIAIDGNFDDALKIVRSICEKSPIALVNSVNPYRIEGQKTAAFEVCEQLGEAPDVL
AIPVGNAGNITAYWKGFKEYHEKNGTGLPKMRGFEAEGAAAIVRNEVIENPETIATAIRI
GNPASWDKAVKAAEESNGKIDEVTDDEILHAYQLIARVEGVFAEPGSCASIAGVLKQVKS
GEIPKGSKVVAVLTGNGLKDPNTAVDISEIKPVTLPTDEDSILEYVKGAARV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaggacttatccatcaatataaagaatttttacctgtaacagatcaaacaccg
gcgctaactttacatgaaggaaacacacctcttattcacctgccgaagctgtctgagcag
ctcggaattgagcttcatgtcaaaacggaaggcgtcaatcctacgggatcatttaaagat
cgcggaatggttatggctgtggcaaaggcaaaagaagaaggcaatgacacgattatgtgc
gcgtcaacaggtaacacttccgctgctgcggcagcatatgcagcccgtgctaacatgaaa
tgcattgtcatcatcccgaacggaaaaattgcatttggaaaactcgctcaagctgtcatg
tacggagccgagattatcgcaattgacggaaactttgacgatgcgcttaaaattgtccgt
tccatctgtgagaaatcaccgattgcccttgtcaactcagtcaacccttaccgcattgaa
ggccaaaaaactgctgccttcgaagtgtgcgaacagctgggggaagcgcctgatgtttta
gcgatcccggtcggaaatgctggaaacatcactgcgtactggaagggcttcaaggaatat
catgagaaaaacggcacaggccttccgaaaatgcgcggctttgaagctgagggtgcggcg
gcaatcgtgcgcaatgaagtgattgaaaatccggaaacaatagcgacagccattcgtatc
ggaaacccggcaagctgggacaaagctgtaaaggcagccgaggaatccaatgggaaaatt
gacgaagtcactgatgatgaaatccttcacgcatatcagctgatcgcccgtgtagaaggc
gtgtttgcagaaccaggttcttgcgcgtctatcgcaggagtgctgaaacaggtgaaatcc
ggagaaattccgaaaggcagcaaggtcgtagctgtgttaacaggaaacggactgaaagat
ccgaacacagcggtcgacatttcagaaatcaagcctgtcacattgccgactgatgaagac
agcatccttgaatatgtaaaaggagcggcccgtgtatga

DBGET integrated database retrieval system