KEGG   Bacillus subtilis subsp. subtilis 168: BSU32260Help
Entry
BSU32260          CDS       T00010                                 

Gene name
hom
Definition
(RefSeq) homoserine dehydrogenase
  KO
K00003  homoserine dehydrogenase [EC:1.1.1.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00270  Cysteine and methionine metabolism
bsu00300  Lysine biosynthesis
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01130  Biosynthesis of antibiotics
bsu01230  Biosynthesis of amino acids
Module
bsu_M00017  Methionine biosynthesis, apartate => homoserine => methionine
bsu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU32260 (hom)
   00270 Cysteine and methionine metabolism
    BSU32260 (hom)
   00300 Lysine biosynthesis
    BSU32260 (hom)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.3  homoserine dehydrogenase
     BSU32260 (hom)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homoserine_dh NAD_binding_3 ACT ACT_4 GFO_IDH_MocA DXP_reductoisom Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 936654
NCBI-ProteinID: NP_391106
Pasteur: BG10460
BSORF: BG10460
UniProt: P19582
Position
complement(3314828..3316129)
Genome map
AA seq 433 aa AA seqDB search
MKAIRVGLLGLGTVGSGVVKIIQDHQDKLMHQVGCPVTIKKVLVKDLEKKREVDLPKEVL
TTEVYDVIDDPDVDVVIEVIGGVEQTKQYLVDALRSKKHVVTANKDLMAVYGSELLAEAK
ENGCDIYFEASVAGGIPILRTLEEGLSSDRITKMMGIVNGTTNFILTKMIKEKSPYEEVL
KEAQDLGFAEADPTSDVEGLDAARKMAILARLGFSMNVDLEDVKVKGISQITDEDISFSK
RLGYTMKLIGIAQRDGSKIEVSVQPTLLPDHHPLSAVHNEFNAVYVYGEAVGETMFYGPG
AGSMPTATSVVSDLVAVMKNMRLGVTGNSFVGPQYEKNMKSPSDIYAQQFLRIHVKDEVG
SFSKITSVFSERGVSFEKILQLPIKGHDELAEIVIVTHHTSEADFSDILQNLNDLEVVQE
VKSTYRVEGNGWS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagcgattcgtgtagggcttttaggtttaggtaccgtcggaagcggtgtcgttaaa
attattcaagaccatcaggataagcttatgcatcaggtcggctgtccggttacgataaaa
aaagtgcttgtaaaagatttagagaaaaagagagaagtagatttgccgaaggaagtgctc
acgacagaagtgtatgatgtcattgatgatccagatgttgatgtcgtcatcgaggtgatc
ggcggcgttgaacagacaaaacaatatttggtcgacgcgctgagatcgaaaaagcatgtt
gtcacagcaaacaaggacttaatggctgtgtacggctccgagctgcttgccgaagcgaag
gaaaatggatgcgatatctactttgaagccagtgttgccggcgggattccgattctgcgc
acgttagaggaaggcctctcatcagatcgaattacaaaaatgatgggaattgtgaacggc
acaacaaactttatcttaaccaaaatgatcaaagagaaaagcccatacgaggaagtgctc
aaggaagcgcaggatctcggttttgccgaagctgatccgacttctgacgtggaagggctt
gacgccgcacggaaaatggcgatattggcgcgcctcggcttctcgatgaacgtggatctg
gaagacgtcaaagtaaaggggatctcccaaattacagacgaggacatcagcttcagcaaa
cgcctcggctatacaatgaagctgatcgggattgctcagcgtgacggcagcaaaatcgag
gtcagcgtacagccgacactgcttcctgaccatcatccgctttctgctgttcataatgag
tttaacgctgtttatgtatacggcgaggctgtcggtgagacgatgttctacgggccggga
gccggaagcatgccgacagcgacatccgttgtttctgacctcgtcgctgtcatgaaaaat
atgcgcctaggtgtaaccggcaacagctttgtcggaccgcaatatgagaaaaacatgaaa
tcgccgtctgacatttatgcacagcagtttttaagaattcatgtaaaagatgaggttggt
tcattctcgaaaattacatctgtgttctcagagcggggcgtgagctttgaaaaaatcctt
cagctgccaattaaaggccatgatgagttagctgaaatcgtaattgtcacacatcataca
tcagaagctgatttcagtgatatcctgcaaaacctaaatgatttggaagtcgttcaagaa
gtcaaaagcacatatcgtgtagaagggaacggttggagctaa

DBGET integrated database retrieval system