KEGG   Bacillus subtilis subsp. subtilis 168: BSU32270Help
Entry
BSU32270          CDS       T00010                                 

Gene name
yutH
Definition
(RefSeq) endospore coat-associated protein YutH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4812
Motif
Other DBs
NCBI-GeneID: 936635
NCBI-ProteinID: NP_391107
Pasteur: BG14044
BSORF: BG14044
UniProt: O32123
Position
complement(3316330..3317349)
Genome map
AA seq 339 aa AA seqDB search
MVKGTIKEKYGIHIRQLSMYQHTYQCFQTPNSYFLIVPVSQFSETELAELYYMSQYLQEQ
SDPYVSVFIFTKEGELTFEHEGKTYALLKAAPPYSNRAFSIGAELAEFHRKGRGYPYEVK
AAGRIGQWKDLWGKRIDQLEAFWQRKVQTPPHEPFDKKMIESFPYYLGLSENAIQYLVDT
ELDDKPQAADSGTICHQRMERHTWSPESLIRIPADWVFDHASRDLAEYMRHTFLHHRQDF
NQQGFLFLQEYEQVTPLSSFSKRLLYSRLLFPLHYFEIVESYYMSSESEKHYFEEQLDFI
LNDCGRYEQFLNTAQEFMNMRAQKLFVPRVSWLGKGSSR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaggtacaataaaagaaaaatacggcattcacatcaggcagctttccatgtac
cagcacacatatcaatgctttcagacgcctaattcatactttctgattgtccccgtttcc
caattctcagaaacagagctggcggagctttattacatgagtcagtatttacaagaacaa
agtgacccatacgtttcggtttttatctttacaaaagaaggtgaactgacatttgaacat
gagggaaaaacgtacgctctgctgaaggcggcccccccttattcaaacagggcgttctcc
attggagcggagcttgcggaatttcaccgaaaaggccgaggatatccatatgaggtgaag
gcggccggaagaatcggccagtggaaggatctgtggggaaaacgaattgatcagctggaa
gcattttggcagagaaaggttcagacccctccgcatgagccattcgataaaaaaatgatc
gaatcatttccatattatttaggactgtcagaaaacgcgatacaatatttagtggacact
gagctggatgacaagccccaagccgctgattcaggaacgatatgccatcagcggatggaa
aggcatacatggtcaccggaatcattgatcaggattccggcggattgggtgtttgaccac
gcttcccgtgatttggctgaatatatgaggcatacgtttttgcatcacagacaagatttt
aatcagcagggctttctctttttacaggaatacgagcaagtcacaccgctgtcttcattt
tcgaaacgccttttatacagccgtctgcttttcccgcttcattattttgaaatcgtagaa
agctattacatgtcatcagaatcagaaaagcattattttgaagaacagcttgacttcatt
cttaatgactgtgggcgttatgaacaatttctcaatacagcgcaggaattcatgaatatg
cgggcgcagaagctgtttgttccacgcgtcagctggctcggcaaaggcagctcaaggtga

DBGET integrated database retrieval system