KEGG   Bacillus subtilis subsp. subtilis 168: BSU32280
Entry
BSU32280          CDS       T00010                                 

Gene name
yutG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PgpA
Other DBs
NCBI-GeneID: 936659
NCBI-ProteinID: NP_391108
Pasteur: BG14043
BSORF: BG14043
UniProt: O32124 A0A6M4JNB7
Position
3317502..3318002
AA seq 166 aa
MSENEQFSQMEAKARARMKERGVEVSDIAELVFFLQKKYHPDLTIDECTLNVNRVLAKRE
VQNAILTGIELDVLAEQKKLSEPLQTMLEIDESLYGVDEVLAFSIVNIYGSIGFTNYGYI
DKEKPGILKRLNDKSTGECHTFLDDIVGAISAAASSRLAHRARHTE
NT seq 501 nt   +upstreamnt  +downstreamnt
atgtcagaaaacgaacaattcagtcagatggaagctaaagcaagagcacggatgaaggag
cgcggcgttgaggtatcagacattgccgagcttgtcttttttctgcagaaaaaatatcat
ccggatttaaccattgatgaatgcacgctgaacgtcaatcgtgttctcgcaaaacgcgag
gtgcaaaacgcgattttaacgggcattgaattggatgttcttgctgagcagaaaaaattg
tctgaaccgctgcaaacgatgctggaaatagatgaaagcctatatggagtagatgaagtt
ctggcattttccattgtgaacatttacggatcgatcgggtttacgaactacggttacatc
gacaaagaaaaacccggaatccttaaacgattgaatgataaatcaaccggtgaatgccat
acctttttagatgacatcgtcggagcgatttccgccgcggcttcaagcagacttgctcac
cgcgcgcggcatacagaataa

DBGET integrated database retrieval system