KEGG   Bacillus subtilis subsp. subtilis 168: BSU32280Help
Entry
BSU32280          CDS       T00010                                 

Gene name
yutG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PgpA DUF4258 Swi3
Motif
Other DBs
NCBI-GeneID: 936659
NCBI-ProteinID: NP_391108
Pasteur: BG14043
BSORF: BG14043
UniProt: O32124
Position
3317502..3318002
Genome map
AA seq 166 aa AA seqDB search
MSENEQFSQMEAKARARMKERGVEVSDIAELVFFLQKKYHPDLTIDECTLNVNRVLAKRE
VQNAILTGIELDVLAEQKKLSEPLQTMLEIDESLYGVDEVLAFSIVNIYGSIGFTNYGYI
DKEKPGILKRLNDKSTGECHTFLDDIVGAISAAASSRLAHRARHTE
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaacgaacaattcagtcagatggaagctaaagcaagagcacggatgaaggag
cgcggcgttgaggtatcagacattgccgagcttgtcttttttctgcagaaaaaatatcat
ccggatttaaccattgatgaatgcacgctgaacgtcaatcgtgttctcgcaaaacgcgag
gtgcaaaacgcgattttaacgggcattgaattggatgttcttgctgagcagaaaaaattg
tctgaaccgctgcaaacgatgctggaaatagatgaaagcctatatggagtagatgaagtt
ctggcattttccattgtgaacatttacggatcgatcgggtttacgaactacggttacatc
gacaaagaaaaacccggaatccttaaacgattgaatgataaatcaaccggtgaatgccat
acctttttagatgacatcgtcggagcgatttccgccgcggcttcaagcagacttgctcac
cgcgcgcggcatacagaataa

DBGET integrated database retrieval system