KEGG   Bacillus subtilis subsp. subtilis 168: BSU32290Help
Entry
BSU32290          CDS       T00010                                 

Gene name
yutF
Definition
(RefSeq) hydrolase YutF
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00627  Aminobenzoate degradation
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSU32290 (yutF)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     BSU32290 (yutF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase Hydrolase_3 Acid_phosphat_B
Motif
Other DBs
NCBI-GeneID: 936508
NCBI-ProteinID: NP_391109
Pasteur: BG14042
BSORF: BG14042
UniProt: O32125
Structure
PDB: 

Position
complement(3318029..3318799)
Genome map
AA seq 256 aa AA seqDB search
MKTYKGYLIDLDGTMYNGTEKIEEACEFVRTLKDRGVPYLFVTNNSSRTPKQVADKLVSF
DIPATEEQVFTTSMATAQHIAQQKKDASVYVIGEEGIRQAIEENGLTFGGENADFVVVGI
DRSITYEKFAVGCLAIRNGARFISTNGDIAIPTERGLLPGNGSLTSVLTVSTGVQPVFIG
KPESIIMEQAMRVLGTDVSETLMVGDNYATDIMAGINAGMDTLLVHTGVTKREHMTDDME
KPTHAIDSLTEWIPYI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatataaagggtatttaattgatttagacggaacgatgtacaatggcacggaa
aaaatcgaggaggcgtgtgaatttgtcagaacgctgaaagatcgcggcgttccttatctt
ttcgtgacaaacaactcttcgcgcacaccgaagcaggtagcggacaagctcgtgtctttt
gatattccggcaacagaagagcaggtcttcacgaccagcatggcaactgcccagcacatt
gcacagcagaaaaaagacgcgtctgtgtatgtgattggggaggaaggaatccgccaggcg
attgaagaaaacggcctgacatttggcggagaaaacgcggattttgtcgttgttggcatc
gaccgttccattacatacgaaaaatttgctgttggctgcctggcaatcagaaatggcgcc
cgctttatttccactaacggagatattgcgattccgactgaaagagggctcctgccggga
aacggctcactgacatcggtgttaaccgtatctacaggtgtacagcctgtatttatcggc
aagccggaatcaattattatggagcaggcgatgcgcgttctcggcacagatgtgtctgaa
acactcatggtcggcgacaactacgccactgatattatggccggcattaacgcgggtatg
gatacgctgctcgttcacacaggcgtaacgaaaagagaacatatgacagacgatatggaa
aaaccgactcacgccattgactctctgactgaatggattccatacatttga

DBGET integrated database retrieval system