KEGG   Bacillus subtilis subsp. subtilis 168: BSU32300Help
Entry
BSU32300          CDS       T00010                                 

Gene name
yutE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF86
Motif
Other DBs
NCBI-GeneID: 938483
NCBI-ProteinID: NP_391110
Pasteur: BG14041
BSORF: BG14041
UniProt: O32126
Structure
PDB: 

Position
complement(3318828..3319262)
Genome map
AA seq 144 aa AA seqDB search
MYFVDRSKIEKTLGFFEHQLALFDSQTDWQSEIGELALQRIGHLLIECILDTGNDMIDGF
IMRDPGSYDDIMDILVDEKVVTEKEGDELKKLIAYRKTLVQQYLLADSGELYRLIKAHQT
ALQDFPKRIRSYLETELGPVSAFK
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtattttgttgacagaagcaaaatcgaaaaaacactagggttcttcgagcaccagctg
gcgctatttgactcacaaacagactggcagtctgaaatcggggaattggcacttcagcgt
ataggccatctgttaatcgaatgcattttggatacaggcaatgacatgattgacggcttt
attatgcgggacccgggcagctatgacgacattatggatatacttgttgatgagaaagtt
gtcacggaaaaagagggtgatgagctcaaaaaattgatcgcctaccgcaaaacgttggtt
caacagtatctgctcgctgacagcggcgagctttacaggctgatcaaggcgcatcaaaca
gctcttcaggacttcccgaaacggatcagaagctatttggaaacagagctaggacctgtt
tccgcgtttaaataa

DBGET integrated database retrieval system