KEGG   Bacillus subtilis subsp. subtilis 168: BSU32300
Entry
BSU32300          CDS       T00010                                 

Gene name
yutE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF86
Other DBs
NCBI-GeneID: 938483
NCBI-ProteinID: NP_391110
Pasteur: BG14041
BSORF: BG14041
UniProt: O32126 A0A6M3ZGJ8
Structure
PDB: 
1YLM

Position
complement(3318828..3319262)
AA seq 144 aa
MYFVDRSKIEKTLGFFEHQLALFDSQTDWQSEIGELALQRIGHLLIECILDTGNDMIDGF
IMRDPGSYDDIMDILVDEKVVTEKEGDELKKLIAYRKTLVQQYLLADSGELYRLIKAHQT
ALQDFPKRIRSYLETELGPVSAFK
NT seq 435 nt   +upstreamnt  +downstreamnt
atgtattttgttgacagaagcaaaatcgaaaaaacactagggttcttcgagcaccagctg
gcgctatttgactcacaaacagactggcagtctgaaatcggggaattggcacttcagcgt
ataggccatctgttaatcgaatgcattttggatacaggcaatgacatgattgacggcttt
attatgcgggacccgggcagctatgacgacattatggatatacttgttgatgagaaagtt
gtcacggaaaaagagggtgatgagctcaaaaaattgatcgcctaccgcaaaacgttggtt
caacagtatctgctcgctgacagcggcgagctttacaggctgatcaaggcgcatcaaaca
gctcttcaggacttcccgaaacggatcagaagctatttggaaacagagctaggacctgtt
tccgcgtttaaataa

DBGET integrated database retrieval system