KEGG   Bacillus subtilis subsp. subtilis 168: BSU32310Help
Entry
BSU32310          CDS       T00010                                 

Gene name
yutD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1027
Motif
Other DBs
NCBI-GeneID: 937182
NCBI-ProteinID: NP_391111
Pasteur: BG14040
BSORF: BG14040
UniProt: O32127
Structure
PDB: 

Position
complement(3319286..3319561)
Genome map
AA seq 91 aa AA seqDB search
MILIQNAEFELVHNFKDGFNEEAFKARYSDILNKYDYIVGDWGYGQLRLKGFFDDQNQKA
TFETKISTLDEYIYEYCNFGCAYFVLKRIRK
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgattcttattcaaaatgccgaatttgaattggtgcacaatttcaaagacggcttcaac
gaagaggcttttaaagcccgctactccgatatattaaataaatacgattatattgtggga
gactggggatacggtcagttaaggctcaagggcttctttgacgaccagaatcaaaaggca
accttcgaaacgaaaatcagcacattagatgaatatatttacgaatactgcaatttcggc
tgtgcgtattttgtcttgaaacggatcagaaaataa

DBGET integrated database retrieval system