KEGG   Bacillus subtilis subsp. subtilis 168: BSU32320Help
Entry
BSU32320          CDS       T00010                                 

Gene name
yutC
Definition
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_YhcN_YlaJ
Motif
Other DBs
NCBI-GeneID: 936674
NCBI-ProteinID: NP_391112
Pasteur: BG14039
BSORF: BG14039
UniProt: O32128
Position
3319676..3320308
Genome map
AA seq 210 aa AA seqDB search
MKRTAVSLCLLTGLLSGCGGAGLDNAQNVRNQTQNQTKPIHVSDRNEAFNRHNENEQFGY
VRYQKEQFDGEQQKTPVMNREETAHMISSLTVQLPHIQDAATLVTDREALVVYKTDSKNR
ELTADQVKKTAASVIPRYYHVYISDNPNHMQSVENYSNLGSGSRDIREIMSGTIQEMKTS
PQGSPVSENENANGETRQDMKIDRNDKNAR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaaccgctgtcagcctctgcctgctgaccggactattatccgggtgcggaggc
gcaggattggataatgcccaaaatgtccggaatcagacgcagaatcaaaccaaacccatt
catgtgtcggaccgcaacgaggcttttaacaggcataatgagaacgaacaatttggctat
gtccgctatcaaaaagaacaatttgacggagaacagcagaaaacgccggtgatgaaccgg
gaagaaaccgctcacatgatatcaagtttaacggttcagctcccccatattcaagatgct
gcgacattggtgactgaccgagaagcgcttgtcgtatacaaaaccgattctaaaaaccgg
gagctgaccgccgatcaggtgaaaaaaacagcggcttctgtgataccgcgatactatcac
gtgtatatttccgataatccaaaccatatgcaatccgtcgaaaattacagcaatctcggc
tctggttcaagggatattagagagatcatgtcggggacgattcaagaaatgaaaacctcc
ccgcaaggaagccctgtctcagagaatgaaaatgccaatggagaaacgcgtcaggacatg
aaaatcgataggaatgacaaaaacgccagatga

DBGET integrated database retrieval system