KEGG   Bacillus subtilis subsp. subtilis 168: BSU32330
Entry
BSU32330          CDS       T00010                                 

Gene name
lipA
Definition
(RefSeq) lipoyl synthase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00785  Lipoic acid metabolism
bsu01100  Metabolic pathways
bsu01240  Biosynthesis of cofactors
Module
bsu_M00883  Lipoic acid biosynthesis, animals and bacteria, octanoyl-ACP => dihydrolipoyl-H => dihydrolipoyl-E2
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    BSU32330 (lipA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     BSU32330 (lipA)
SSDB
Motif
Pfam: Radical_SAM LIAS_N
Other DBs
NCBI-GeneID: 938861
NCBI-ProteinID: NP_391113
Pasteur: BG14038
BSORF: BG14038
UniProt: O32129 A0A6M4JLV8
Position
complement(3320324..3321220)
AA seq 298 aa
MAKKDEHLRKPEWLKIKLNTNENYTGLKKLMRENNLHTVCEEAKCPNIHECWAVRRTATF
MILGSVCTRACRFCAVKTGLPTELDLQEPERVADSVALMNLKHAVITAVARDDQKDGGAG
IFAETVRAIRRKSPFTTIEVLPSDMGGNYDNLKTLMDTRPDILNHNIETVRRLTPRVRAR
ATYDRSLEFLRRAKEMQPDIPTKSSIMIGLGETKEEIIEVMDDLLANNVDIMAIGQYLQP
TKKHLKVQKYYHPDEFAELKEIAMQKGFSHCEAGPLVRSSYHADEQVNEASKKRQAQA
NT seq 897 nt   +upstreamnt  +downstreamnt
ttggcaaagaaagacgaacacctcagaaagcccgaatggcttaaaattaaattaaataca
aatgaaaactatacagggctcaaaaaactcatgcgggaaaacaacctgcataccgtatgc
gaagaagcaaagtgtccgaatattcatgaatgctgggcggtcagacgtacagcgacattt
atgattttaggttctgtttgtacaagagcatgccgtttctgtgctgtcaaaacaggcctt
ccaactgagcttgatctgcaagagccggaacgcgtagcggattcagtcgcgcttatgaat
ttgaaacacgcggtcattacggctgttgcgcgtgacgatcagaaagatggcggggcaggc
attttcgcggaaactgtccgtgcgatccgcagaaaaagcccgttcacaacaattgaggtg
ctgccgtctgatatgggcggaaactacgataacctaaaaaccttgatggatacacgccca
gacatcctgaatcacaatatcgaaacggttcgccgcctgacgccaagagtccgcgcgcgt
gcgacgtacgaccgttcattggaatttttgcgccgtgcgaaggaaatgcagcctgacatt
ccgacaaaatcaagtatcatgatcggactcggcgaaacaaaagaagagattattgaagta
atggacgacctcttggcgaacaacgtggatattatggcaatcggccaatatctgcagccg
acgaagaaacacttgaaagtccaaaaatactaccatcctgatgaatttgcagaattaaaa
gaaatcgcgatgcaaaaaggcttcagccattgtgaagccggtccgcttgtccgttcctct
taccatgcggatgaacaagtaaacgaagcatctaaaaagcgtcaagcacaagcataa

DBGET integrated database retrieval system