KEGG   Bacillus subtilis subsp. subtilis 168: BSU32340Help
Entry
BSU32340          CDS       T00010                                 

Gene name
lytH
Definition
(RefSeq) L-Ala--D-Glu endopeptidase
  KO
K21472  peptidoglycan LD-endopeptidase LytH [EC:3.4.-.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU32340 (lytH)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
    BSU32340 (lytH)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     BSU32340 (lytH)
Peptidases [BR:bsu01002]
 Metallo Peptidases
  Family M23
   BSU32340 (lytH)
Peptidoglycan biosynthesis and degradation proteins [BR:bsu01011]
 Peptidoglycan biosynthesis and degradation
  Endopeptidase
   BSU32340 (lytH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M23
Motif
Other DBs
NCBI-GeneID: 936510
NCBI-ProteinID: NP_391114
Pasteur: BG13975
BSORF: BG13975
UniProt: O32130
Position
3321455..3322435
Genome map
AA seq 326 aa AA seqDB search
MKVLLSALLLLLFAFEPSASGKKLSDPVLSKRMELYHKIEAVTQIPWYALAAVDQYEENV
RSNRKDLPEKAGIISIYIPDDIWSGPENPNPKDDAPLSIKVFDGIGMDGDGDGKAEVSND
EDILYTFSQYLLSYGTDEDNIRIGLWNYYRRDQTVGIISEFMKLFKAYGHIDLGEHAFPL
PIRTDYSYRSTWGDARGFGGRRIHEGTDIFAHYGLPVKSTCYGVVEMKGWNRFGGWRIGI
RDINNTYHYFAHLNGFAKGIKTGQIVEPGQVIGSVGSSGYGPPGTAGKFPPHLHYGMYKD
NGRTEWSFDPYPHLRAWERYEYQKKK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttttgttatccgctcttcttctccttttgtttgcatttgagccttctgcgtct
ggaaaaaaactttcagatccagtgctgtcgaaacggatggaattatatcataaaatcgaa
gctgtgacgcagatcccttggtatgcgctcgccgctgttgatcaatacgaagaaaacgtg
cggagcaaccggaaagatctgcctgaaaaggcgggaatcatcagcatctatatacccgat
gatatctggagcgggcctgaaaacccgaatccgaaagacgatgcgccgttaagcattaaa
gtgtttgacggaatcggaatggatggcgatggagacgggaaagccgaggtcagcaacgat
gaagatatcttgtatacgttcagccaatacttactgtcgtatggcacagatgaagacaac
atccggatcgggctttggaattattaccggcgtgatcagacagtggggattatatctgaa
ttcatgaagctgtttaaagcctacggccatattgatctgggcgagcatgcattcccgctt
ccgatcagaaccgattacagctaccgaagcacgtggggagatgcccgcggcttcggtgga
aggcggattcatgaaggtacggatatctttgcccattacggccttcctgtcaaatccaca
tgttacggcgtagttgaaatgaagggctggaaccgcttcggaggatggagaatcggcatc
agggacattaacaatacgtatcattattttgcccatctcaatgggtttgccaaagggatt
aaaacaggacaaatcgttgagcctggccaagtgatcggatcagtcggcagctccggatac
ggcccgccgggaaccgccgggaagttcccgccgcatctgcactatggcatgtacaaagat
aacggaagaaccgaatggtcatttgatccatacccgcatttgagggcgtgggagcgatat
gaataccaaaaaaagaagtaa

DBGET integrated database retrieval system