KEGG   Bacillus subtilis subsp. subtilis 168: BSU32350Help
Entry
BSU32350          CDS       T00010                                 

Gene name
yunB
Definition
(RefSeq) sporulation protein YunB
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spore_YunB
Motif
Other DBs
NCBI-GeneID: 936670
NCBI-ProteinID: NP_391115
Pasteur: BG13976
BSORF: BG13976
UniProt: O32131
Position
complement(3322463..3323227)
Genome map
AA seq 254 aa AA seqDB search
MPRYRGPFRKRGPLPFRYVMLLSVVFFILSTTVSLWMINGSIKPVLMDIGEMETKRIATE
VIQDSIEDYMSDSENMKDMFQMNSDENGNLTTIDFNTQVVNSVKTKVTKQLQAHLKEMET
HTGHSGASENIMINIPLGQVTGNSLLGNLGPKIPVRFNLIGDAFTDVKTKIKPYGINNAL
IDISIFVEIKVKVIIPFASKTAVVTNNVPVSIKAVQGEVPQFYNGSGGSGVTPSVQLPSS
KENGADSKKEKSSK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
ttgccaagatatcgcggcccttttcgcaagagaggacctttgcctttccgttacgtgatg
ctcctgtccgttgtcttttttatcctgtcaacaacggtcagcctttggatgatcaatggc
tcgatcaaacctgttttaatggacatcggcgagatggaaacgaagcgtatagcgacagag
gtgatccaggattcgattgaggactatatgtctgacagtgaaaatatgaaagatatgttt
caaatgaattctgatgaaaacggaaacttaacgacaatcgattttaatacacaggttgta
aacagtgtgaaaacaaaagtgacaaagcagcttcaggctcatttgaaagagatggaaacc
cataccggacacagcggcgccagtgaaaacattatgatcaacattccgctgggacaggta
accggcaacagccttcttggaaacctcgggccgaaaatcccggtccggttcaatttaatc
ggtgacgcttttacagatgtcaaaaccaaaatcaagccgtatggcataaataacgcactt
attgatatcagcatctttgtcgaaattaaagtgaaggtcatcattccatttgccagcaaa
accgctgtcgtcacaaataatgttcctgtatcgattaaagcagtgcagggcgaagtgccg
cagttttataatggaagcggcggctcgggtgtcacgccttctgtccagcttccgagcagc
aaagaaaacggtgccgattcaaaaaaagaaaaaagcagcaaataa

DBGET integrated database retrieval system