KEGG   Bacillus subtilis subsp. subtilis 168: BSU32360Help
Entry
BSU32360          CDS       T00010                                 

Gene name
yunC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1805
Motif
Other DBs
NCBI-GeneID: 936679
NCBI-ProteinID: NP_391116
Pasteur: BG13977
BSORF: BG13977
UniProt: O32132
Position
complement(3323300..3323605)
Genome map
AA seq 101 aa AA seqDB search
MVNLTPIMIEGQPFTAVTVKLPKTNFMAVANDHGYIMCGALDVALLNEKLKERGIVAGRA
VGVRTIDQLLDAPLESVTYAAEDLGIKVGMSGREALLKMMK
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaacctgacaccgatcatgatagaaggacagccttttacagctgtgacagtaaag
cttcccaaaacgaattttatggccgtcgccaatgatcacggatacattatgtgcggcgcg
cttgatgtggcgctgctgaatgaaaaattaaaggagcgcggcatcgtggcgggacgcgca
gttggtgtccgcaccattgaccagctgttagacgcacctttagaatccgtcacgtacgct
gcggaagatcttggcatcaaagtcggcatgagcggcagagaagcgcttttaaaaatgatg
aaataa

DBGET integrated database retrieval system