KEGG   Bacillus subtilis subsp. subtilis 168: BSU32370Help
Entry
BSU32370          CDS       T00010                                 

Gene name
yunD
Definition
(RefSeq) metallophosphoesterase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5_nucleotid_C
Motif
Other DBs
NCBI-GeneID: 936666
NCBI-ProteinID: NP_391117
Pasteur: BG13978
BSORF: BG13978
UniProt: O32133
Position
complement(3323670..3325058)
Genome map
AA seq 462 aa AA seqDB search
MKEKLRLYHTNDLHSHFENWPKIVDYIEQKRKEHQSDGEETLVFDIGDHLDRFQFVTEAT
FGKANVDLLNRLHIDGAAIGNNEGITLPHEELAALYDHAEFPVIVSNLFDKNGNRPSWAV
PYHIKSLKNGMSIAFLGVTVPYYPVYDKLGWTVTDALESIKETILEVKGQADIIVLLSHL
GILDDQAVAEAVPEIDVILESHTHHLLEDGQVVNGVLLASAEKYGHYVGCVEITVDSVQR
SINSKTASVQNMAEWTGESAETKAFLNEKEREAEEKLSDAVAELAQDAEVKWFEESELPL
LLAYALKEWCETDISMVNSGVILGPLKAGPVTKLDLHRICPHPINPVAVRLTGEELKETI
VHAASEQMEQLRIKGLGFRGEVMGKMVYAGVEVETKRLDDGITHVTRITLNGEDIEKHKQ
YSVAVLDMFTLGKLFPLIRDAAEKEYFMPEFLRDLLAWKLAQ
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagaagctccgcttatatcatacaaatgatttgcacagccattttgaaaactgg
ccgaaaattgtagattatatcgagcagaaaagaaaagagcatcagtcagacggcgaagag
acgctcgtttttgatattggcgatcatcttgatcgttttcaattcgtgacagaggcgaca
ttcggaaaagcgaatgtcgatctcttaaaccgccttcacattgatggagcggcgatcggc
aataacgaagggattacgcttccgcatgaagagcttgctgccttatatgatcatgctgaa
tttcctgtcatcgtctctaacctgtttgataaaaatggaaaccgtccgtcctgggcggtg
ccttaccatatcaaatcattgaaaaacggtatgtccattgctttcttaggtgtaactgtg
ccgtattatcctgtatatgacaagctgggatggacagttacggatgcccttgaaagcata
aaggaaaccattctggaagtgaaagggcaggctgatattatcgttctgctgtcacattta
ggcattcttgatgatcaagcagtggctgaagcggtgcctgagattgatgtaatcctcgaa
tcacatacccatcatttgctcgaagatggacaagtggttaatggggtactgctggccagc
gccgagaaatacgggcattatgtcggctgtgtagaaatcacggtggacagcgtacagcga
agcatcaacagcaaaacggcttctgtgcagaacatggcggaatggacaggagaatccgca
gaaactaaagcgtttctcaatgaaaaagaacgtgaagccgaggagaaactgtccgatgcc
gttgcagagcttgcacaagatgctgaggtgaagtggtttgaagaatcagagctgcctttg
cttttggcatacgccttaaaggaatggtgcgagacggacatcagtatggtcaattcaggt
gtcattctcggtccgctaaaagcaggtcctgtgacaaagctggatctgcaccgcatctgt
ccgcatccgatcaacccggtggctgtccgcctgacgggagaagaactgaaggaaaccatt
gtccatgccgcttccgaacaaatggagcagctccggatcaaaggactcggcttccgcgga
gaagtgatggggaaaatggtgtatgccggcgttgaggtagaaacgaaacggctcgatgac
gggatcacccacgtcactcggatcacactgaacggggaagatattgaaaaacataaacaa
tactccgttgcggtgcttgatatgtttacgctcggcaaactgtttccgttgattcgcgac
gctgcagaaaaagaatattttatgccggaatttttgcgggatctgcttgcttggaagctt
gcacaataa

DBGET integrated database retrieval system