KEGG   Bacillus subtilis subsp. subtilis 168: BSU32380Help
Entry
BSU32380          CDS       T00010                                 

Gene name
yunE
Definition
(RefSeq) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU32380 (yunE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-GeneID: 936506
NCBI-ProteinID: NP_391118
Pasteur: BG13979
BSORF: BG13979
UniProt: O32134
Position
complement(3325078..3325899)
Genome map
AA seq 273 aa AA seqDB search
MSFVILVVLGLIAGTVGSLIGLGGGIVIVPSLMFLSTVTQLFQDVTPQVAIGTSLLVIIF
TGLSSTLAYIKYKTVDYKSGLIFFIGSGPGSMIGAYVSKLFNSNSFSVWFGIFMILISLS
LMLKAKARPINKAHKGIIRTFQDDAGEPYTYSYQASVGIAIAFVVGFLGGLFGIGGGSLM
VPAMMLLFLFPPKVAVATSMFIIFLSSMTGSVSHMISGHVNWLYALALVPGAWFGGKLGA
AINRKMQTKTIVMIMRIVLILIGCQLIYEGIFS
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgtgattttggtcgtactgggattaatcgcaggtacggtaggaagtctgatc
gggcttggcggcggaattgtcattgtgccatctctgatgtttttaagcacagtgacgcag
ctgtttcaggatgtgacgccgcaggttgcgattggaacttcgcttttggtcattattttt
acgggcctttcttcaactttggcttatattaaatataaaacagttgattataagagcgga
ctcattttctttatcggttcgggtcccggcagcatgatcggggcttacgtgtcaaagctg
ttcaattcaaactcgttttccgtttggtttggcatttttatgattctgatttcattatcc
ttaatgctgaaagcgaaagcccggccaatcaacaaagcgcacaaaggaattatccggaca
tttcaggatgatgccggtgagccttatacgtactcatatcaggcctctgtcggtattgcc
attgcctttgttgtcggttttttaggcggacttttcggtataggcggcggatcactgatg
gttccggcgatgatgctgttatttctgtttccgccgaaggttgcggtggcaacgtccatg
tttattattttcctgtcttctatgacagggtctgtttcacatatgatttccgggcacgtc
aattggctgtacgccctcgcgcttgtgcccggcgcttggttcggcggaaagcttggcgcc
gccatcaacagaaaaatgcagacgaaaacgatcgttatgatcatgcggatcgtattgatt
ttgatcggctgccagctcatttatgaaggcattttcagctga

DBGET integrated database retrieval system