KEGG   Bacillus subtilis subsp. subtilis 168: BSU32390Help
Entry
BSU32390          CDS       T00010                                 

Gene name
yunF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF72
Motif
Other DBs
NCBI-GeneID: 937089
NCBI-ProteinID: NP_391119
Pasteur: BG13980
BSORF: BG13980
UniProt: O32135
Position
complement(3325917..3326765)
Genome map
AA seq 282 aa AA seqDB search
MIYIGLTGWGDHDSIYPPKTASQKKLQAYSSHFPIVELDASFYAIQPARNNEKWVKETPE
TFQFIVKAYQGMTGHQRGEIPFDSKEEMFDAFKVSLTPYLHSNKLAMVLFQFPPWFDCKK
ENVAYLRWCKHQMGDIPCALEFRNRSWFSPPFYEQTLSFMKAEGWIHSVCDEPQIGEGSV
PTVLRATDENKTLVRFHGRNKQGWMKPDGGKNWREVRYLYRYNQQELEDWKKHLNELQQQ
CKDVFVLFNNNSGGDAADNGKQMLELLDIEYSGLAPRQLDLF
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgatttatatcggactgacgggatggggggatcatgacagcatctatccgccgaaaacg
gccagccagaaaaaattgcaggcctattcctcccattttccgatcgtggaattagacgcg
agcttttacgcgattcagccggcgcgcaataatgaaaagtgggtgaaggaaacgcccgaa
accttccaatttatcgtgaaagcatatcagggcatgacagggcatcagcgcggcgaaatt
ccctttgactcaaaagaggagatgtttgatgcgtttaaggtgtctttaacgccatattta
catagcaataagctcgccatggtgctgtttcaatttccgccgtggtttgactgcaagaag
gagaatgtcgcctatttgagatggtgtaagcaccaaatgggagatattccttgcgcgctt
gaattcagaaaccgttcctggttctcgccgccattttatgagcagacgctttcatttatg
aaagcggaaggctggattcacagtgtctgtgatgaaccgcaaatcggagaaggcagcgtt
ccgaccgtgttgcgcgcgaccgatgaaaacaaaacgctcgtcaggtttcacggacgcaac
aagcagggctggatgaagcctgatggcgggaaaaactggcgggaggtcaggtacttatac
cgctacaaccaacaggagctggaggattggaaaaagcacctgaatgaattgcagcagcaa
tgtaaggatgtttttgtcctgttcaacaacaattccggcggtgacgctgcggataatggc
aagcagatgcttgaactgcttgatatcgagtacagcggacttgctccgagacagctcgat
ttattttag

DBGET integrated database retrieval system