KEGG   Bacillus subtilis subsp. subtilis 168: BSU32400Help
Entry
BSU32400          CDS       T00010                                 

Gene name
yunG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 936684
NCBI-ProteinID: NP_391120
Pasteur: BG13981
BSORF: BG13981
UniProt: O32136
Position
complement(3326803..3327150)
Genome map
AA seq 115 aa AA seqDB search
MEHVKYILKQSWSRHSSSKWTEECPSCGQCGVTALVIQDHFGGTIFKTRVDESWHFYNSI
NGVVYDFTSEQFQAPIEYQHIPSSREEAFLDTNEEQYQHLREAFSRHMNSISEET
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggagcatgtcaaatacatacttaagcaatcctggtcgcgccattcgagctctaaatgg
acggaagaatgcccgtcatgcggccaatgcggcgtgacggcattggtgattcaagaccat
ttcggcggcacgattttcaaaacaagagtcgatgagagctggcatttttataacagcatc
aatggtgtggtgtacgattttacgagtgagcagtttcaggcgcctattgaatatcagcac
attccttcctcaagagaagaggcgtttttagatacgaatgaggaacaatatcagcatttg
cgtgaggcattttcccgccatatgaacagcatttccgaggaaacctga

DBGET integrated database retrieval system