KEGG   Bacillus subtilis subsp. subtilis 168: BSU32420Help
Entry
BSU32420          CDS       T00010                                 

Gene name
pucR
Definition
(RefSeq) purine catabolism regulatory protein
  KO
K09684  purine catabolism regulatory protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU32420 (pucR)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSU32420 (pucR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PucR HTH_30 GGDEF_2 sCache_like CENP-L HTH_1 DUF5376 HTH_8
Motif
Other DBs
NCBI-GeneID: 937221
NCBI-ProteinID: NP_391122
Pasteur: BG13983
BSORF: BG13983
UniProt: O32138
Position
3328762..3330357
Genome map
AA seq 531 aa AA seqDB search
MNILDVMKIPAFENANLIAGKAGGEREVQHVNMMDAPDIVDFLHKNELLVTTAYHLKDHP
HQLSELIRQMAKRGCAGLGIKTKRYLEDIPKEIIELADSYAFPIIELPEHIRLGDIVNAT
LSHILDMRSNELQQAIYAHKKFTNHIMSGKGLQSLLKKVSDILQLPVLLLDQHAKMLSAS
HQISVETEKLKGTLNTVSGPFFTCFSTISDQKTYSVLPIYNHEKNCGYLLIPDMVQAGDK
GLILTIEQAANVISFELLKENALKQFSRRARNEFFNNFIERTFSSDDEIKNRAKEFKLRW
DQKYMCIAGKLDRNDESISFTENQLASDSVFEFLEGELSAFPFPPHFFMKGNVGIILIEA
TDSWSEMHASVISFLEQFQTQVSAQFKRTVSFGISNICQKLIDVPDAFTEASDALQSGHL
SRSTAFIQVYHAKDVPELLRLLPVEDLKKFYNSTLQSLAEKQQEDQSLLHTLSVYLETHC
QISETAKRLYVHRNTVIYRLEKCEELLGKSLKDPETTMRLRLALRMQRLIS
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcttgatgtgatgaaaataccggcttttgaaaacgccaatttaatcgctgga
aaagcaggaggggaaagagaggttcagcatgtcaatatgatggacgctccggatatcgta
gactttttgcataagaatgaattgctcgtcaccaccgcctatcacctgaaggatcacccg
catcaattatctgaactgattcggcaaatggcaaaacgcggctgcgcgggcctcggcatt
aaaacaaagcgctatctggaagatatcccgaaggaaatcatcgaactggccgattcatat
gcgtttccgatcattgagcttccggaacacatccgactcggcgatattgtgaatgccaca
ctcagccatattctcgatatgcgttctaacgagctgcagcaagccatttacgcgcacaaa
aaattcacaaaccacattatgagcggcaaggggctgcaatccctcctcaaaaaggtgtca
gacatccttcagcttcccgtgctgctgcttgaccagcatgccaaaatgctgtctgcgtct
catcagatttcagttgagaccgaaaagctgaaaggcaccctgaataccgtatccgggcca
tttttcacttgtttctctacaatctcagatcagaaaacatattctgtcctgcctatttat
aatcacgaaaaaaactgcggctacctgctgatacccgacatggtgcaggcaggcgacaaa
ggattgatcctcacgattgaacaagcggccaacgtcatttcctttgaactgctgaaggaa
aatgcgctgaagcagttcagccggcgggcccgcaatgagtttttcaacaattttattgag
cggaccttttcttcagatgacgaaatcaaaaaccgggcgaaagaattcaagctgcgctgg
gatcaaaaatacatgtgcatcgccggcaaactcgatcgcaatgacgaatcaatcagcttt
acagaaaatcagctcgcttccgacagcgtattcgaatttcttgaaggtgaattatcagcc
ttcccgtttccacctcacttctttatgaaaggaaatgtcggcattattctaatcgaggcg
acagacagctggagtgaaatgcacgcctcggtgatcagctttttagaacagtttcaaaca
caggtcagcgctcaatttaaacgaaccgtgtcctttggcatcagcaatatctgccaaaag
ctcattgatgttcccgacgctttcacagaagcttctgatgctctgcaatcggggcatttg
tcaagaagcaccgcatttatccaggtgtatcacgccaaagatgtgcctgagcttctgcgc
ttgctcccagttgaggatttgaagaaattttacaactccacgcttcagagcctcgctgaa
aaacagcaggaggatcaaagcctgcttcatacgctttccgtctatttagagacacactgc
caaatttcagagacggcaaagcgtctgtacgttcatcgcaatacggtcatataccgcctt
gaaaaatgcgaagagcttctggggaaaagcttaaaagatcctgaaacaacgatgcgtttg
cggcttgcattacgtatgcagcggctgatcagctaa

DBGET integrated database retrieval system