KEGG   Bacillus subtilis subsp. subtilis 168: BSU32430Help
Entry
BSU32430          CDS       T00010                                 

Gene name
pucJ
Definition
(RefSeq) uric acid permease PucJ
  KO
K16170  uric acid permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32430 (pucJ)
Transporters [BR:bsu02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU32430 (pucJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xan_ur_permease
Motif
Other DBs
NCBI-GeneID: 937096
NCBI-ProteinID: NP_391123
Pasteur: BG13984
BSORF: BG13984
UniProt: O32139
Position
3330502..3331851
Genome map
AA seq 449 aa AA seqDB search
MKKRSFKVFTLSLQHVLAMYAGAILVPLLVGRALNVTTEQLSYLLAIDLLTCGVATLLQT
LRGTYIGIGLPVMLGSSFVAVTPMIAIGSNYGIHAIYGSIIAAGVFIFLFARFFGKLTVL
FPPVVTGTVVTLIGLSLVPTGVKNMAGGEKINGSANPEYGSLENLLLSVGVLVLILVLNR
FLKGFARTLSVLIGIAAGTAAAAIMGKVSFSSVTEAPFFQIPKPFYFGAPAFEIGPILTM
LIVGIVIIVESTGVFYAIGKICGRPLTDKDLVKGYRAEGIAILIGGLFNAFPYNTFAQNA
GLLQLTKVKTRNIVVTAGCILVCLGLIPKIAALASAVPAAVLGGATVVMFGMVIASGVKM
LSTADLKNQYHLLTIACSIALGIGASTAPGIFAEFPAPIRILVSDGTITGSLTAIFLNLF
FSLRDKKELTAQQTELPVLEHTLALEKEV
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaagatcgtttaaggtgtttacacttagcctgcagcatgtgctcgccatgtat
gcaggtgcgattttggtgcccctgcttgtcggcagggcgctgaatgtaacaactgaacag
ctgtcctacctattggcgattgacctgttaacatgcggcgtcgctacgcttttgcaaacc
ttgcgcggaacatacatcggcatcgggcttcccgtcatgcttggcagttcatttgtggcc
gtcaccccaatgattgcaatcggcagcaattacggcattcacgcgatttatggttccatc
attgcggccggtgtgttcatctttttgtttgcgcgttttttcggcaagctgactgtgtta
tttcctcctgtcgtaacaggtaccgttgtgaccttgatcggcctttcacttgttccgaca
ggtgtgaaaaatatggctggcggcgaaaaaataaacggcagcgccaaccccgaatacggt
tcgctcgaaaaccttcttctctctgtcggtgtccttgttctgatcttagtcctcaaccgc
tttctcaaaggatttgcccgaacactgtccgttctgatcggcatcgccgccggaacagcg
gcagcagcgatcatgggcaaagtcagcttttcttctgttacagaagcaccgttcttccaa
atcccgaagcctttttacttcggagcccctgcgtttgaaatcggtccgatcttaacgatg
ctgatcgtcggaatcgtcattattgtggaatcaaccggcgttttttacgcaatcggaaag
atatgcggcagacctttaactgacaaagatctcgtcaaaggctatcgagcggaaggaatc
gccattctcatcggcgggctgttcaatgcctttccttataatacctttgcgcaaaacgcc
ggcttattgcagctgaccaaagtgaaaacaagaaacatcgtcgttaccgcaggctgtatc
cttgtctgtctcggactgattccgaagattgccgcccttgcatctgccgttcctgctgct
gtacttggcggcgcgaccgtcgtcatgttcggcatggtgattgcctccggcgtcaaaatg
ctcagcacagcggatctcaaaaatcaataccacctcctgaccatcgcatgctcaatcgca
ctcggcatcggcgccagcacggcccccgggatttttgctgaattccccgctccgatccgg
attctggtcagtgacggcaccatcaccggaagcctaaccgccatctttttgaatctattt
ttcagcttgcgcgacaaaaaagaattaacagcacagcaaacagaacttccggtattagaa
catacactcgcattagaaaaagaggtgtaa

DBGET integrated database retrieval system