KEGG   Bacillus subtilis subsp. subtilis 168: BSU32440
Entry
BSU32440          CDS       T00010                                 

Gene name
pucK
Definition
(RefSeq) uric acid permease PucK
  KO
K16170  uric acid permease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32440 (pucK)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU32440 (pucK)
SSDB
Motif
Pfam: Xan_ur_permease MFS_MOT1
Other DBs
NCBI-GeneID: 937191
NCBI-ProteinID: NP_391124
Pasteur: BG13985
BSORF: BG13985
UniProt: O32140 A0A6M3ZGA9
Position
3331857..3333149
AA seq 430 aa
MKEQHNALQLMMLGLQHMLAMYAGAILVPLIVGAAIGLNAGQLTYLIAIDLFMCGAATLL
QLWRNRYFGIGLPVVLGCTFTAVGPMISIGSTYGVPAIYGAIIAAGLIVVLAAGFFGKLV
RFFPPVVTGSVVMIIGISLIPTAMNNLAGGEGSKEFGSLDNVLLGFGVTAFILLLFYFFK
GFIRSIAILLGLIAGTAAAYFMGKVDFSEVLEASWLHVPSLFYFGPPTFELPAVVTMLLV
AIVSLVESTGVYFALADITNRRLSEKDLEKGYRAEGLAILLGGLFNAFPYTAFSQNVGIV
QLSKMKSVNVIAITGIILVAIGLVPKAAALTTVIPTPVLGGAMIVMFGMVISYGIKMLSS
VDLDSQGNLLIIASSVSLGLGATTVPALFSSLSGAASVLAGSGIVIGSLTAIALHAFFQT
KQPNSADIKT
NT seq 1293 nt   +upstreamnt  +downstreamnt
atgaaggaacagcacaatgccttacagctaatgatgctggggcttcagcacatgcttgcc
atgtatgcgggagccattctcgttccgttgatcgtcggagcagcgatcgggctgaatgcg
gggcagctgacgtatttaatcgcgattgatttgtttatgtgcggggcggcaactcttttg
cagctctggagaaaccgatatttcggcatcggccttcccgttgtgctcggatgcacgttt
accgcagtcggcccgatgatttccatcggaagcacttacggtgtcccagcgatatatggt
gccattatcgccgcaggactgattgtcgtcttagccgcgggcttcttcgggaagcttgtc
cgtttttttccgcctgtcgtaaccggatcagtcgtcatgatcatcggcatcagcctgatt
ccaacggcaatgaataacctggccggaggtgaaggaagcaaagaattcggctcactcgac
aacgtgctcctcgggtttggcgtcacagcttttatcttattgctgttttatttctttaaa
ggctttatccgctccatagcgattttactcggtcttatcgcaggaacagcggctgcatat
ttcatgggaaaggtcgatttttctgaggttttggaggcgtcttggcttcatgttccgtct
ctgttttatttcggaccgccaacctttgagctgccggctgttgtcacgatgcttctcgtt
gcaattgtcagcctcgttgaatcgacaggcgtttattttgccctcgctgatatcacaaac
cgcaggctgtcggagaaggatctggaaaaaggctaccgggcagaaggccttgcgattttg
ctgggcggcttatttaacgcgtttccctatacagctttctcgcagaatgtcggcatcgtt
cagctctcaaagatgaaaagtgtcaacgtcatcgccatcacaggaatcatactggtcgcg
atcgggctggttccaaaagcagcggccctgacaacagtgatccccaccccagttctcggc
ggcgcaatgatcgtcatgttcggcatggtcatttcttacgggatcaaaatgctatccagc
gttgaccttgattcgcaaggcaacctgctgattatcgcctcttccgtcagcttggggctt
ggcgctacaacagttcccgcgttgttttcatctctttcgggcgcggcctctgtcttggca
ggaagcggaattgtgatcggcagtttgacggccattgcactgcacgctttttttcaaacc
aaacagccgaatagcgcagacataaaaacgtaa

DBGET integrated database retrieval system