KEGG   Bacillus subtilis subsp. subtilis 168: BSU32440Help
Entry
BSU32440          CDS       T00010                                 

Gene name
pucK
Definition
(RefSeq) uric acid permease PucK
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xan_ur_permease MFS_MOT1
Motif
Other DBs
NCBI-GeneID: 937191
NCBI-ProteinID: NP_391124
Pasteur: BG13985
BSORF: BG13985
UniProt: O32140
Position
3331857..3333149
Genome map
AA seq 430 aa AA seqDB search
MKEQHNALQLMMLGLQHMLAMYAGAILVPLIVGAAIGLNAGQLTYLIAIDLFMCGAATLL
QLWRNRYFGIGLPVVLGCTFTAVGPMISIGSTYGVPAIYGAIIAAGLIVVLAAGFFGKLV
RFFPPVVTGSVVMIIGISLIPTAMNNLAGGEGSKEFGSLDNVLLGFGVTAFILLLFYFFK
GFIRSIAILLGLIAGTAAAYFMGKVDFSEVLEASWLHVPSLFYFGPPTFELPAVVTMLLV
AIVSLVESTGVYFALADITNRRLSEKDLEKGYRAEGLAILLGGLFNAFPYTAFSQNVGIV
QLSKMKSVNVIAITGIILVAIGLVPKAAALTTVIPTPVLGGAMIVMFGMVISYGIKMLSS
VDLDSQGNLLIIASSVSLGLGATTVPALFSSLSGAASVLAGSGIVIGSLTAIALHAFFQT
KQPNSADIKT
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaacagcacaatgccttacagctaatgatgctggggcttcagcacatgcttgcc
atgtatgcgggagccattctcgttccgttgatcgtcggagcagcgatcgggctgaatgcg
gggcagctgacgtatttaatcgcgattgatttgtttatgtgcggggcggcaactcttttg
cagctctggagaaaccgatatttcggcatcggccttcccgttgtgctcggatgcacgttt
accgcagtcggcccgatgatttccatcggaagcacttacggtgtcccagcgatatatggt
gccattatcgccgcaggactgattgtcgtcttagccgcgggcttcttcgggaagcttgtc
cgtttttttccgcctgtcgtaaccggatcagtcgtcatgatcatcggcatcagcctgatt
ccaacggcaatgaataacctggccggaggtgaaggaagcaaagaattcggctcactcgac
aacgtgctcctcgggtttggcgtcacagcttttatcttattgctgttttatttctttaaa
ggctttatccgctccatagcgattttactcggtcttatcgcaggaacagcggctgcatat
ttcatgggaaaggtcgatttttctgaggttttggaggcgtcttggcttcatgttccgtct
ctgttttatttcggaccgccaacctttgagctgccggctgttgtcacgatgcttctcgtt
gcaattgtcagcctcgttgaatcgacaggcgtttattttgccctcgctgatatcacaaac
cgcaggctgtcggagaaggatctggaaaaaggctaccgggcagaaggccttgcgattttg
ctgggcggcttatttaacgcgtttccctatacagctttctcgcagaatgtcggcatcgtt
cagctctcaaagatgaaaagtgtcaacgtcatcgccatcacaggaatcatactggtcgcg
atcgggctggttccaaaagcagcggccctgacaacagtgatccccaccccagttctcggc
ggcgcaatgatcgtcatgttcggcatggtcatttcttacgggatcaaaatgctatccagc
gttgaccttgattcgcaaggcaacctgctgattatcgcctcttccgtcagcttggggctt
ggcgctacaacagttcccgcgttgttttcatctctttcgggcgcggcctctgtcttggca
ggaagcggaattgtgatcggcagtttgacggccattgcactgcacgctttttttcaaacc
aaacagccgaatagcgcagacataaaaacgtaa

DBGET integrated database retrieval system