KEGG   Bacillus subtilis subsp. subtilis 168: BSU32460Help
Entry
BSU32460          CDS       T00010                                 

Gene name
pucM
Definition
(RefSeq) 5-hydroxyisourate hydrolase
  KO
K07127  5-hydroxyisourate hydrolase [EC:3.5.2.17]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU32460 (pucM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU32460 (pucM)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.17  hydroxyisourate hydrolase
     BSU32460 (pucM)
Transporters [BR:bsu02000]
 Other Transporters
  Others
   BSU32460 (pucM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transthyretin CarboxypepD_reg PDDEXK_9 bMG3
Motif
Other DBs
NCBI-GeneID: 937977
NCBI-ProteinID: NP_391126
Pasteur: BG13987
BSORF: BG13987
UniProt: O32142
Structure
PDB: 

Position
3334646..3334990
Genome map
AA seq 114 aa AA seqDB search
MGKLTTHILDLTCGKPAANVKIGLKRLGESIMKEVYTNNDGRVDVPLLAGEELMSGEYVM
EFHAGDYFASKNMNAADQPFLTIVTVRFQLADPDAHYHIPLLLSPFGYQVYRGS
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaactgacaacccatattttagatttaacctgcggcaaaccagcggcgaacgta
aaaattggattgaagcggctgggcgaaagtattatgaaagaggtatacactaacaatgac
ggcagggtcgatgtccctctgctggctggtgaagagctgatgtcaggagagtatgtgatg
gaatttcatgcaggagactattttgcgagtaaaaacatgaacgcagccgatcagccgttt
ttaaccatcgtcaccgtccgttttcagctagcagatccagatgcacattatcatatcccg
ctcttgctgtcgccgtttggttatcaggtgtatagggggagttaa

DBGET integrated database retrieval system