KEGG   Bacillus subtilis subsp. subtilis 168: BSU32510Help
Entry
BSU32510          CDS       T00010                                 

Gene name
pucA
Definition
(RefSeq) xanthine dehydrogenase subunit A
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU32510 (pucA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     BSU32510 (pucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XdhC_C XdhC_CoxI
Motif
Other DBs
NCBI-GeneID: 938865
NCBI-ProteinID: NP_391131
Pasteur: BG13992
BSORF: BG13992
UniProt: O32147
Position
complement(3339945..3340937)
Genome map
AA seq 330 aa AA seqDB search
MGNFHTMLDALLEDQEEAVLATIVQVEGSAYRKAGASMLFKKKGRRIGLLSGGCVEEDVF
QRISALGDQLTSTLIPYDMRSEDDLSWGMGAGCNGIIHVHAERITQEKRRHYEKVRDCLH
SGKAVTSVIKIESSHYLFLTENGHFGNWPDAPLQDIQRTVSTLHLPHFDQTTNMFIQRIE
PKPRLILFGAGPDNVPLANLAADTGFSVIVTDWRPAYCTSSLFPKADQLITAFPEQMLSE
FQFFPHDAAVVATHHYQHDQTIINFLFSQNLHYIGLLGSANRTKRLLSGKHPPSHFYSPV
GLKIGAEGPEEIAVSVVAEIIQTRKRVAVV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
ttggggaattttcacacgatgttagatgcgctcctggaagaccaggaggaggctgtactg
gcgacaattgttcaagttgaaggctccgcgtatcgaaaagcaggcgcctctatgctcttt
aagaaaaaaggcagacggattggcttgctgagcggcgggtgtgtggaagaagatgtattc
caaagaatcagtgcgctgggcgatcagctcacatcaacgctgattccctacgacatgcgg
tcggaggacgatctttcttggggcatgggagccgggtgcaatggcattattcatgttcat
gcagagcgaatcactcaggaaaaaaggcggcactatgagaaagtgagggactgccttcat
tcaggcaaagctgtcacttccgttataaagattgaatcctcccattatttatttctgacg
gagaacggacattttgggaactggccggacgcgcctctgcaagatattcaacgtactgtt
tcaacgcttcatttaccgcatttcgatcaaaccactaacatgtttattcagcgaattgaa
ccgaagccgcgtctcattctgtttggggcgggaccggataatgtaccgctggccaatttg
gcggctgacacagggttttctgttatcgtgacggattggcggcccgcttattgtacatcc
tctctttttccaaaagcggatcagctgatcaccgcttttccggaacaaatgcttagcgaa
tttcaattttttccgcatgatgcagctgttgtggcaacccatcattatcagcacgatcaa
acgatcatcaacttcttattttctcaaaacctccattatattggactgttgggttcggca
aaccgcacgaaacggctgctgagcggaaaacatcctccgtctcacttttacagtccggtc
gggctgaaaatcggtgcggaaggtcccgaggaaattgcggtaagtgtagttgcagaaatc
attcaaacaagaaaacgggtggcggttgtatga

DBGET integrated database retrieval system