KEGG   Bacillus subtilis subsp. subtilis 168: BSU32520Help
Entry
BSU32520          CDS       T00010                                 

Gene name
pucG
Definition
(RefSeq) purine catabolism protein PucG
  KO
K00839  (S)-ureidoglycine---glyoxylate transaminase [EC:2.6.1.112]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU32520 (pucG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsu01007]
    BSU32520 (pucG)
Enzymes [BR:bsu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.112  (S)-ureidoglycine---glyoxylate transaminase
     BSU32520 (pucG)
Amino acid related enzymes [BR:bsu01007]
 Aminotransferase (transaminase)
  Class V
   BSU32520 (pucG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 RMMBL Par3_HAL_N_term
Motif
Other DBs
NCBI-GeneID: 936676
NCBI-ProteinID: NP_391132
Pasteur: BG13993
BSORF: BG13993
UniProt: O32148
Structure
PDB: 

Position
complement(3341166..3342416)
Genome map
AA seq 416 aa AA seqDB search
MSGRRELCTPLRTIMTPGPVEVDPRVLRVMSTPVVGQFDPAFTGIMNETMEMLRELFQTK
NRWAYPIDGTSRAGIEAVLASVIEPEDDVLIPIYGRFGYLLTEIAERYGANVHMLECEWG
TVFDPEDIIREIKKVKPKIVAMVHGETSTGRIHPLKAIGEACRTEDALFIVDAVATIGGC
EVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAARKKVERGIATQADRAALSG
NRPITSNYFDLSQLEDYWSERRLNHHTEATTMLYALREGVRLVLEEGLETRFERHRHHEA
ALAAGIKAMGLRLFGDDSCKMPVVTCVEIPGGIDGESVRDMLLAQFGIEIASSFGPLAGK
IWRIGTMGYSCRKENVLFVLAGLEAVLLRHNAGIEAGKALQAALDVYENAGRQAAV
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaggcagaagagaattatgcaccccgttaagaacgattatgacaccggggcctgtt
gaggttgatccgcgtgtattaagagtaatgagcaccccggttgtcggccaatttgatccg
gcgtttacaggtattatgaatgaaacgatggagatgcttcgggagctgttccaaacaaaa
aaccgctgggcatacccgattgacggcacttcacgggcgggaattgaagcagtgctggct
agtgtgatagagccggaagatgatgtgctcattcccatttacggccgtttcggttatttg
ctgactgaaatcgccgagcgatatggggcaaatgttcatatgctggagtgcgaatgggga
acggtttttgacccggaggacatcatacgggagataaaaaaagtgaagccgaaaattgtg
gccatggtgcatggagaaacatcgacaggacggattcacccgctgaaagccatcggcgaa
gcctgccgcaccgaggatgcattgtttatcgtcgatgcagtcgcaacgattgggggctgc
gaggttaaagtcgatgaatggaagattgacgctgccatcggcggaacgcaaaaatgtttg
tctgtgccttcaggaatggcgccgattacatataatgagcgggtggcggacgtgattgca
gctcgcaaaaaggtggaacgcgggattgcgacacaagctgacagggcagcactttcggga
aatcggccaattacaagcaactactttgatttgagccagcttgaggattattggagcgaa
agacggctcaatcatcatacagaagcgacgacgatgctgtacgccttacgtgagggagtc
agactggtgcttgaagaaggtcttgagacgcgtttcgagcggcatcggcaccatgaagcc
gcattagcagcagggataaaggcaatggggctaagattgtttggagatgacagctgcaaa
atgcctgttgtcacctgtgtcgaaattcccggcggcattgacggcgagtctgtccgtgac
atgctgctggcacaattcggcattgaaatcgccagctcattcggcccgcttgcagggaag
atctggaggatcggcacgatggggtacagctgcagaaaagaaaacgtgctattcgtgctt
gccgggttagaggctgtgcttctcagacataacgcaggaatcgaagcaggaaaagcgctc
caagcagcgctggatgtgtatgaaaacgctggccgccaggcagcggtgtaa

DBGET integrated database retrieval system