KEGG   Bacillus subtilis subsp. subtilis 168: BSU32530Help
Entry
BSU32530          CDS       T00010                                 

Gene name
yurH
Definition
(RefSeq) allantoate amidohydrolase
  KO
K02083  allantoate deiminase [EC:3.5.3.9]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00230  Purine metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSU32530 (yurH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bsu01002]
    BSU32530 (yurH)
Enzymes [BR:bsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.9  allantoate deiminase
     BSU32530 (yurH)
Peptidases [BR:bsu01002]
 Metallo Peptidases
  Family M20
   BSU32530 (yurH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 Peptidase_M28 M20_dimer
Motif
Other DBs
NCBI-GeneID: 936699
NCBI-ProteinID: NP_391133
Pasteur: BG13994
BSORF: BG13994
UniProt: O32149
Position
complement(3342433..3343671)
Genome map
AA seq 412 aa AA seqDB search
MEKQKLSVKNSITDYIEWLAQYGASADGGVTRLLYTKEWMDAQLAVKTEMSSFGLETRFD
DVGNVFGRLSGTQSPDEVIVTGSHIDTVINGGKYDGAYGVLAAMLALKQLKETYGAPKKT
LEAVSLCEEEGSRFPMTYWGSGNMTGVFSEQDAKEPRDESGVSLQTAMHESGFGKGVFQS
AYRTDISAFVELHIEQGKTLEMSGRDLGIVTSIAGQRRYLVTLEGECNHAGTTSMKWRKD
PLAASSRIIHELLLRSDELPDELRLTCGKITAEPNVANVIPGRVQFSIDIRHQHQHVLEQ
FHQDMVALINGICLQKGIRAVIDEYMRIEPVPMDERLKAAAFETALENGFSCEEMVSGAG
HDAQMIGRRYPACMLFVPSRGGVSHSPKEYTSARQLEIGVRALTDLLYKLAY
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcagaagctttcagtaaaaaacagcatcacagattatattgaatggctcgcc
caatacggtgcgtctgcggatggcggcgtaacgaggcttttatacacaaaagagtggatg
gacgcacagcttgctgtgaaaacggaaatgtcttctttcgggcttgaaacaagattcgac
gatgtcggcaatgtgtttggaaggctttcgggcacccagtctccggatgaagtcattgta
accggttcacatatcgatactgtcatcaatggaggaaaatacgacggcgcctatggcgtt
ctggcggcaatgctcgcgttaaagcagctcaaggaaacatacggagcgccaaaaaaaacg
ctcgaggcggtctccttatgtgaggaggaaggcagccgttttccaatgacctattggggg
tcggggaatatgacgggtgttttttcagaacaagatgcaaaagagccaagagacgagtcg
ggagtctccctccaaacagcgatgcatgagagcggttttggcaaaggtgtgtttcagtca
gcatataggacagatatcagcgcgtttgttgagctgcatattgaacaggggaagacgttg
gaaatgtcaggccgggatctcggcatcgtgacaagtattgcggggcagagacgatatctc
gtcacgctcgaaggagaatgcaatcacgcaggaaccacctccatgaaatggcgcaaggac
ccgctcgcagccagcagccgtatcattcatgagctgctgctgcggtcggatgagctgccg
gatgagctccgtctgacatgcggaaaaataacggcagagcccaatgtagccaatgtcata
ccgggccgcgtccagttttcaatcgatattcgccatcagcatcagcatgtgctggaacag
tttcatcaagacatggttgctttgatcaacggcatttgcctacaaaaaggaattcgcgct
gtgattgatgaatatatgcggatagagcctgtgccgatggacgaaaggctgaaggctgcg
gcttttgaaacagcattagaaaacggcttcagctgtgaggaaatggtgagcggagcaggg
catgacgcgcaaatgatcggaaggcgctatcctgcttgtatgctgtttgtgccgagccga
ggcggcgtcagccactcaccgaaggaatatacgtcagccagacagcttgagatcggcgtc
cgcgcactgactgatttattatacaaactggcttactga

DBGET integrated database retrieval system