KEGG   Bacillus subtilis subsp. subtilis 168: BSU32540Help
Entry
BSU32540          CDS       T00010                                 

Gene name
bsn
Definition
(RefSeq) extracellular ribonuclease
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Endonuclease_1
Motif
Other DBs
NCBI-GeneID: 936687
NCBI-ProteinID: NP_391134
Pasteur: BG13995
BSORF: BG13995
UniProt: O32150
Position
3344113..3344979
Genome map
AA seq 288 aa AA seqDB search
MTKKAWFLPLVCVLLISGWLAPAASASAQTTLSLNDRLASSPSGTGSLLSLAAPAAPYAD
TDTYYEGAEGKTGDSLKSTLHRIISGHTMLSYSEVWNALKETDEDPRNPNNVILLYTNES
RSKNLNGGNVGDWNREHVWAKSHGDFGTSKGPGTDIHHLRPADVQVNSARGNMDFDNGGT
EYAKAPGNYYDGDSWEPRDDVKGDVARMLFYMAVRYEGDDGYPDLELNDKTGNGSAPYHG
KQSVLLEWNKQDPVDDRERKRNEIIYEKYQHNRNPFIDHPEWADEIWP
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaagcatggtttctgccgctcgtctgtgtattactgatttccggatggctt
gcgccagcagcttcagcaagcgcgcaaaccacattaagccttaatgaccgattggcgtct
tccccttcaggaacgggaagccttctctcattagccgcccccgctgcaccctatgctgac
acagatacctattatgaaggggctgaaggtaaaacaggagactcgctaaaaagcaccctg
caccgtattatcagcggacacacgatgctgtcctacagcgaagtgtggaacgcgctgaaa
gaaacggatgaagacccaagaaatccgaataacgtcatcctgctctatacgaatgaatcg
cgttccaaaaacctgaacggcggcaatgtcggcgattggaaccgcgagcatgtctgggcg
aaatcccatggcgattttggtacgagcaagggacctggtactgatattcatcatttgcgc
ccggctgatgttcaagttaacagcgccagaggaaatatggattttgacaatggcggcact
gaatatgcgaaggcacccggaaattattatgacggcgattcatgggagccccgcgatgat
gtgaaaggcgatgttgcccgcatgctgttttacatggctgtccgttacgagggtgatgac
ggctatcctgatcttgagcttaatgataagacaggcaacggctcagctccttatcatggc
aaacaatctgtcctgctcgaatggaataagcaggatccggttgacgaccgcgagcggaaa
agaaatgaaatcatttatgaaaaatatcagcacaaccgcaatccatttatcgaccaccct
gaatgggcggatgagatttggccgtaa

DBGET integrated database retrieval system